-
Posts
74,774 -
Joined
-
Last visited
-
Days Won
31
Content Type
Profiles
Forums
Articles
Events
Blogs
Everything posted by niman
-
2019-nCoV 61F Patient Visited Other Markets In Wuhan
niman replied to niman's topic in Thailand (2019-nCoV)
Published Date: 2020-01-14 21:22:35 Subject: PRO/AH/EDR> Novel coronavirus (04): China (HU), Thailand ex China, WHO Archive Number: 20200114.6889527 NOVEL CORONAVIRUS (04): CHINA (HUBEI), THAILAND ex CHINA, WHO ************************************************************* A ProMED-mail post http://www.promedmail.org ProMED-mail is a program of the International Society for Infectious Diseases http://www.isid.org In this update: [1] Thailand ex China, no contact with implicated Seafood Market [2] Thailand ex China (Wuhan) - WHO DON 14 Jan 2020 [3] Wuhan Public Health Commission update 14 Jan 2020 [4] Potential for International air travel spread ****** [1] Thailand ex China, no contact with implicated Seafood Market Date: 14 Jan 2020 Source: South China Morning Post [edited] https://www.scmp.com/news/hong-kong/health-environment/article/3046030/wuhan-pneumonia-chinese-tourist-thai-case-did-not The new virus behind recent pneumonia cases in Wuhan is unlikely to cause a widespread, deadly epidemic like SARS [Severe acute respiratory syndrome], scientists say, as revelations that a Chinese tourist in Thailand had not visited the market linked to the outbreak raised fears of a potential spread of the disease. The woman, 61, who was confirmed by Thai authorities to have the new virus, had not visited the now-closed mainland seafood market associated with the outbreak, the Post learned on Tuesday [14 Jan 2020]. The discovery raised fears that the woman, the 1st confirmed case outside China, could have caught the virus in Wuhan at other markets, which she was understood to have visited. That came as Reuters quoted the World Health Organisation as saying there had been "limited" human-to-human transmission of the new coronavirus, but WHO spokesman Tarik Jasarevic told the Post in an email reply that "there has been no evidence" of such an occurrence. Hong Kong's Chief Executive Carrie Lam Cheng Yuet-ngor said an expert meeting would be held on Wednesday [15 Jan 2020] to discuss the latest development of the disease, upon the return of a team of local health officials who visited Wuhan to gain 1st-hand knowledge. When asked why details of the 2-day visit were not disclosed to the public, Lam said: "The trip, organised by the county's National Health Commission, invited not only delegates from Hong Kong, but also from Macau and Taiwan to understand how the mainland authorities have been handling the disease. It has not been kept secret." The tourist, who travelled to Bangkok from the city in Hubei province, was found to have a fever on arrival at Suvarnabhumi Airport on [8 Jan 2020] and was hospitalised that day. She was confirmed on Sunday [12 Jan 2020] to have been infected with the new coronavirus strain, which has struck at least 41 people in Wuhan and killed one. Dr Sopon Eamsiritavorn, from the Thai Ministry of Public Health's Department of Disease Control, told the Post it appeared the woman's infection was not related to the Huanan Seafood Wholesale Market, which Chinese authorities had linked to the Wuhan outbreak and had been closed since [1 Jan 2020]. "It seems there's no relation with the market," he said, when asked whether the patient had visited the outbreak site. A source familiar with the details of the case said the woman did not visit the market. "But she did visit other markets before going to Thailand," the source said. Detailed investigations into the case were in progress. Hong Kong's Centre for Health Protection said on Tuesday [14 Jan 2020] that it had been closely monitoring the case in Thailand. Professor David Hui Shu-cheong, a respiratory medicine expert from Chinese University, had previously said that if the woman had not been to the seafood market, it would suggest that the virus had spread to other parts of Wuhan. Details on investigations in Thailand could be found by following reports from officials there, Jasarevic said. Between [31 Dec 2019] and Tuesday [14 Jan 2020], Hong Kong had reported 71 suspected cases, with 60 of them cleared and discharged. Meanwhile, scientists who have studied the genome of the virus behind the recent outbreak believe it is unlikely to cause a widespread, deadly epidemic like SARS. The unnamed virus has been identified as a new strain of coronavirus, the same family of viruses as severe acute respiratory syndrome [SARS]. Chinese scientists released the virus's genome sequence to the public on Saturday [11 Jan 2020], and researchers who analysed the sequence said it was a distant relative of SARS and, therefore, unlikely to be as deadly. "The description given by the Chinese scientists is accurate. This virus is not SARS-CoV and not particularly close by many standards. Based on previous research ... the virus is likely attenuated in terms of disease," said Vineet Menachery, an assistant professor with the University of Texas Medical Branch's department of microbiology and immunology in Galveston. Menachery analysed the genome sequence and found it had only about 73 per cent similarity to SARS. "In certain patients, older people or people with comorbidities, the virus may cause more damage but is not nearly as problematic as the epidemic SARS-CoV strain," he added. Ralph Baric, a coronavirus researcher at the University of North Carolina, Chapel Hill, came up with a similar conclusion after his team tried to replicate the virus in their laboratory based on the genetic code provided by Chinese scientists. Of the 4 known SARS-related bat viruses capable of infecting humans, this one was the most distant from SARS itself, Baric told Science. Baric also praised the speed of the response to the virus. "One of the things that's sad is that the public doesn't realise how incredibly competent the public health and the basic science community are at going from a newly discovered virus to a tremendous amount of capacity to trace and try to control its spread," he told the journal. Xu Jianguo, head of an evaluation committee advising the Chinese government on the emerging virus, also told Science in an interview published on Friday [10 Jan 2020] that no new patients had appeared since [5 Jan 2020]. "It's good news. People fear something like SARS in 2003, but this is a different case. The outbreak is limited," he said. There had been worries about the transparency of the Chinese government's handling of the outbreak, but now that concern had largely been dismissed, according to the Science report. Dr Hu Ming, deputy director of the department of epidemiology and health statistics at Central South University in Changsha, said she had been following the situation in Wuhan closely and had not found any signs of a cover-up after the health authorities 1st announced the outbreak on [31 Dec 2020]. "There was lots of work to do. Sequencing, for instance, would take time. The data must be verified carefully before release. I believe they are following strict, professional procedures," she said. "We have learned a painful lesson from SARS." Feng Zijian, deputy director of the Chinese Centre for Disease Control and Prevention, told China Central Television on Tuesday [14 Jan 2020] that the genome sequence of the coronavirus had showed it was "neither SARS nor MERS" (Middle East respiratory syndrome) and the difference in their genome sequences was "very big.." SARS infected more than 8000 people, killing over 700 globally after originating in China in 2003. In a Sunday [12 Jan 2020] statement, the WHO said the outbreak was probably associated with 1 seafood market in Wuhan, which had since been closed. It also said it was "reassured of the quality of the ongoing investigations and the response measures implemented in Wuhan, and the commitment to share information regularly." The new virus was isolated, analysed and its genetic information released to the world 10 days after the confirmed outbreak. In 2003, it took more than 3 months to do the same with SARS. [Bylines: Elizabeth Cheung, Jitsiree Thongnoi, Stephen Chen in Beijing, Zhuang Pinghui in Beijing] -- Communicated by: ProMED-mail Rapporteur Kunihiko [For more discussion on these findings, see comment following section [2]. - Mod.MPP] ****** [2] Thailand ex China (Wuhan) - WHO DON 14 Jan 2020 Date: 14 Jan 2020 Source: WHO Emergencies preparedness, response, Disease outbreak news [edited] https://www.who.int/csr/don/14-january-2020-novel-coronavirus-thailand-ex-china/en/ On [13 Jan 2020], the Thailand's Ministry of Public Health (MoPH) reported the 1st imported case of lab-confirmed novel coronavirus (2019-nCoV) from Wuhan, Hubei Province, China. The case is a 61-year-old Chinese woman living in Wuhan City, Hubei Province, China. On [5 Jan 2020], she developed fever with chills, sore throat and headache. On [8 Jan 2020], she took a direct flight to Thailand from Wuhan City together with 5 family members in a tour group of 16 people. The traveler with febrile illness was detected on the same day by thermal surveillance at Suvarnabhumi Airport (BKK), Thailand, and was hospitalized the same day. After temperature check and initial assessment, she was transferred to the hospital for further investigations and treatment. The patient's full exposure history is under investigation. She reported a history of visiting a local fresh market in Wuhan on regular basis prior to the onset of illness on [5 Jan 2020]; however, she did not report visiting the Huanan South China Seafood Market from where most of the cases were detected. Samples tested positive for coronaviruses by reverse transcriptase-polymerase chain reaction (RT-PCR) on [12 Jan 2020]. The genomic sequencing analysis performed by Emerging Infectious Diseases Health Science Center, the Thai Red Cross Society (EID-TRC) and the Thai National Institute of Health (Thai NIH), Department of Medical Sciences confirmed that the patient was infected with the novel coronavirus (2019-nCoV) which was isolated in Wuhan, China (for more information, please see the Disease Outbreak News published on [12 Jan 2020]). As of this writing, the patient is in a stable condition and in hospital. Public health response The Ministry of Public Health Thailand implemented measures for screening travelers from Wuhan city on [3 Jan 2020] at Suvarnabhumi Airport, Don Mueang, Phuket and Chiang Mai airports, and activated enhanced surveillance at public and private hospitals. Since the identification of the case on [5 Jan 2020], Thai health authorities have taken the following measures: - 8 febrile travelers were detected by a thermo-scan at Suvarnabhumi Airport. They have been isolated and tested, and none of them have been confirmed with 2019-nCov infection. - A total of 182 contacts were identified and are being monitored. The contacts were fellow passengers as well as members of the same tour group. Only 1 contact developed respiratory symptoms and the PCR test of throat swab yields positive for Respiratory Syncytial Virus (RSV). - Risk communication guidance has been shared with the public and a hotline has been established by the Department of Disease Control for people returning from the affected area in China with related symptoms. - The Ministry of Public Health of Thailand has international-standard diagnosis and medical care and is closely coordinating with WHO and related departments for the potential response measures. WHO risk assessment - This is the 1st exported case of novel coronavirus from Wuhan city, China. Since the initial report of cases in Wuhan city on [31 Dec 2019], 41 cases have a preliminary diagnosis of 2019-nCoV infection, including 1 death in a person with severe underlying medical conditions (for more information, please see the Disease Outbreak News published on [12 Jan 2020]). As the traveler did not report having visited the market linked to most of the other cases, it is vital that investigations continue to identify the source of infection. To date, China has not reported any cases of infection among healthcare workers or contacts of the cases. Based on the available information there is no clear evidence of human-to-human transmission. No additional cases have been detected since [3 Jan 2020] in China. Additional investigation is needed to ascertain the presence of human-to-human transmission, modes of transmission, common source of exposure and the presence of asymptomatic or mildly symptomatic cases that are undetected. It is critical to review all available information to fully understand the potential transmissibility among humans. WHO advice Health authorities should work with travel, transport and tourism sectors to provide travelers with information to reduce the general risk of acute respiratory infections via travel health clinics, travel agencies, conveyance operators and at points of entry. WHO has provided interim guidance for novel coronaviruses. WHO advises against the application of any travel or trade restrictions on Thailand based on the information currently available on this event. For more information on novel coronavirus, please see: - Technical interim guidance for novel coronavirus, WHO https://www.who.int/health-topics/coronavirus - WHO travel advice for international travel and trade in relation to the outbreak of pneumonia caused by a new coronavirus in China https://www.who.int/ith/2020-0901_outbreak_of_Pneumonia_caused_by_a_new_coronavirus_in_C/en/ - Thailand Ministry of Public Health situation update on novel coronavirus (in Thai) https://ddc.moph.go.th/viralpneumonia/ - Wuhan Municipal Health Commission's briefing on the pneumonia epidemic situation, (in Chinese) http://wjw.wuhan.gov.cn/front/web/list2nd/no/710 -- Communicated by: ProMED-mail Rapporteur Marianne Hopp [There are many interesting points and findings related to this imported case of the Wuhan novel CoV (I'll use Wuhan nCoV for the time being) into Thailand. - 1st, an individual infected with the Wuhan nCoV, travelled outside of Wuhan and was detected on arrival at the Suvarnabhumi Airport in Bangkok via fever screening. Thoughts: the virus is travelling with the multitude of people who are travelling from Wuhan (see section [4] below). - 2nd, the date of onset of illness was 5 Jan 2020, Thoughts: The most recent date of onset in the original cluster of 41 individuals was 2 Jan 2020, so there may be continued transmission. - 3rd, the patient did not visit the Huanan South China Seafood Market but did visit a "local fresh market" on a regular basis prior to illness onset. Thoughts: Transmission was not associated with exposure in the Huanan South China Seafood Market. Possible other sources could involve exposure to host/intermediary host (as yet undefined/unidentified) at another fresh market (presume fresh market means wet market), or possible exposure to an individual who was infected with the Wuhan nCoV, with limited person-to-person transmission. In either event, it is clear that this virus is not isolated to the Huanan South China Seafood Market in Wuhan City. Heightened concerns come with the upcoming Chinese New Year celebrations, with major population movement, and major food preparations, which may include major exposures to wet markets in Wuhan as well as elsewhere in China. Hence the need for rapid identification of the host and possible intermediary hosts. - 4th, clinical presentation was fever, sore throat, headache. Thoughts: a mild upper respiratory infection presentation not always presenting to the health sector for etiology of testing, and if seen in an urgent care center in the USA, would most likely be tested for Group A streptococcal infection and not investigated further. - 5th, sequencing of the virus confirmed it was the Wuhan nCoV. Thoughts: There isn't further information to know whether it was identical to the isolates from the Huanan South China Seafood Market or whether there were differences suggesting a separate introduction (from host to humans) As for comparisons with SARS, it is too early to draw conclusions with 20/20 hindsight on this virus and the clinical and epidemiological presentations. An alarmist point of view could mention that the presumed index case of SARS-CoV infection worked with contact with the implicated civet cats and had date of onset of illness on 22 Nov 2002. The 1st information about the outbreak in Guangdong with "scores of cases including medical personnel dying" was on 10 Feb 2003, and retrospective timeline demonstrated a slow start to the outbreak with the "explosion" happening in January 2003, approximately 6-8 weeks after the index case illness, and 3-4 weeks before news of the outbreak leaked outside of China. Hence, we've potentially identified the index case here with date of onset on 8 Dec 2019, and we are now 4.5 weeks following this index case, potentially not enough time for genetic changes that might produce a more virulent clinical picture in some individuals and might arm the virus with human-to-human transmission capabilities. The optimistic point of view recognizes the transparency and openness of China in terms of releasing information on the initial cluster of cases, the speed in which the virus was identified (less than 1 month vs. 4-5 months for SARS-CoV), and the international collaboration that is occurring at the very near start of this newly identified viral threat. With the given level of cooperation and collaboration, one hopes that any changes in virulence and transmissibility of the virus will be identified early and control measures will be implemented accordingly. One key measure that needs to be in place sooner rather than later is the treatment and response of medical personnel to febrile respiratory illness presentations and the use of respiratory precautions at all points of contact in the medical setting. One should be very cautious about predictions at this stage. A map of Thailand showing provinces can be found at https://legacy.lib.utexas.edu/maps/middle_east_and_asia/thailand_admin-2013.jpg. HealthMap/ProMED-mail maps: China: http://healthmap.org/promed/p/5294 Thailand: http://healthmap.org/promed/p/151 - Mod.MPP] ****** [3] Wuhan Public Health Commission update 14 Jan 2020 Date: 14 Jan 2020 Source: Wuhan Public Health Commission [in Chinese, mach. trans. edited] http://wjw.wuhan.gov.cn/front/web/showDetail/2020011509040 Tuesday, [14 Jan 2020], National People's Health Commission of Hubei Province, Wuhan Municipal People's Government Questions and answers on pneumonia outbreak of new coronavirus infection ([14 Jan 2020]) Issuing authority: Wuhan City health committee 1. Recently, a tourist from Wuhan was diagnosed with a new coronavirus-infected pneumonia patient in Thailand. Please introduce the situation. Response: On [13 Jan 2020], Thailand reported a case of pneumonia with a new coronavirus infection from Wuhan. The city attaches great importance to timely investigation. The patient is a citizen of our city and is now receiving treatment in Thailand with a stable condition. At the same time, the health department conducted medical observations on all close contacts of the patient found, and there is no abnormal performance at present. 2. At present, in order to detect pneumonia cases of new coronavirus infection as early as possible, what measures have been taken in our city? Response: After the outbreak, the city quickly carried out screening of relevant cases in all medical institutions in the city. Up to now, the expert group has integrated the clinical manifestations, epidemiological history, and laboratory test results of patients to determine new cases of pneumonia caused by coronavirus. [There were 41 cases identified]. Recently, our city has further strengthened case monitoring and search. On the one hand, we continue to do a good job of monitoring for pneumonia of unknown cause, and on the other hand, we carry out case searches at various medical institutions at all levels in our city in order to detect cases early. 3. As of now, has there been any case of human-to-human transmission? Response: Existing survey results show that clear evidence of human-to-human transmission has not been found, and the possibility of limited human-to-human transmission cannot be ruled out, but the risk of continued human-to-human transmission is low. Further research is currently underway combining clinical and epidemiological data. 4. Has a family clustering case been found? Response: Among the 41 cases currently diagnosed, one was found to be clustered in the family. The husband and wife developed the disease, with the husband having developed the disease first. He was an employee of the South China Seafood Wholesale Market. His wife denied a history of South China Seafood Wholesale Market exposure. 5. What are close contacts? Why medical observation of close contacts for 14 days? If close contacts develop symptoms during the observation period, how can they be diagnosed and diagnosed? Response: At present, the close contacts defined in this epidemic are those who live with patients, work and study in the same room, live in the same room, and who have not taken effective protective measures during the diagnosis and treatment of cases. In addition, laboratory testing personnel, other patients or accompanying staff in the ward, other contact situations determined by disease control professionals in the same transportation with the patient and close contact with the person. With reference to the incubation period of diseases caused by other coronaviruses, information about this new coronavirus case, and current prevention and control practices, the medical observation period for close contacts is set to 14 days, and home medical observations are made for close contacts. During the observation period, once the close contacts are found to have abnormal clinical manifestations such as fever and cough, the close contacts will be sent to the designated medical institution for investigation, diagnosis and treatment in a timely manner. 6. What are the characteristics of the epidemic that have been found so far? What is the development trend of the epidemic? Response: Of the 41 cases diagnosed, most were male, and the number of middle-aged and elderly people was higher. In the early stage of the case, fever and cough are the main symptoms, which can be manifested as persistent mild disease in the early stage. Older patients with underlying disease are more likely to progress to severe disease. Preliminary results of existing etiology studies and epidemiological investigations show that most of the cases are related to the South China Seafood Wholesale Market exposure, a few cases deny a history of South China Seafood Wholesale Market exposure, and some cases have been exposed to similar cases. No community transmission has been identified. 7. After closing the South China Seafood Wholesale Market, are there any findings in the market? What measures have other markets taken? Response: After the South China Seafood Wholesale Market was closed, the city strengthened its disposal of market environmental hygiene, carried out disinfection and sanitary disposal of the market, and carried out garbage cleaning and disinfection. In order to strengthen the traceability work, environmental specimens were collected and tested in the market. At present, the test results found that some samples were positive for the new coronavirus. At the same time, preliminary investigations have been conducted in other markets, and no clues related to the source of the infection have been found. -- Communicated by: Mary Marshall <[email protected]> [The important information in this Q and A that has not been covered in other reports is the confirmation of one suspected human-to-human transmission from a husband to his wife, and confirmation that there were some confirmed cases with no known contact with the Huanan South China Seafood Wholesale Market or other known cases, further suggesting the Huanan South China Seafood Wholesale Market was not the only possible location for transmission of this newly identified Wuhan nCoV. An excellent interactive map showing the locations of Seafood Markets in Wuhan city can be found at: https://www.google.com/maps/search/map+oF+Wuhan+City+showing+seafood+markets/@30.4943417,114.137178,11z/data=!3m1!4b1. It is impressive but not surprising to see the multitude of markets, presumably "wet markets" in the city, a city with a population over 11 million inhabitants. - Mod.MPP] ****** [4] Potential for International air travel spread Date: 14 Jan 2020 Source: Journal of Travel Medicine [excerpted, edited] https://academic.oup.com/jtm/advance-article/doi/10.1093/jtm/taaa008/5704418 Pneumonia of Unknown Etiology in Wuhan, China: Potential for International Spread Via Commercial Air Travel Bogoch II, Watts A, Thomas-Bachli A, C Huber, Kraemer MUG, Khan K. Journal of Travel Medicine, taaa008, https://doi.org/10.1093/jtm/taaa008. Published: 14 Jan 2020 Highlight: "There is currently an outbreak of a pneumonia of unknown etiology in Wuhan, China. While there are still several unanswered questions, we evaluate the potential for international dissemination of this disease via commercial air travel should the outbreak continue. We evaluated 2018 travel data generated from the International Air Transport Association (IATA) to quantify passenger volumes originating from the international airport in Wuhan, China, between January through March [2018], inclusive. We also report Infectious Disease Vulnerability Index (IDVI) scores for countries receiving significant numbers of travellers from Wuhan. The IDVI score is a validated tool to estimate a country's capacity to prepare for and manage infectious disease threats. A score is based on metrics from seven domains; demographic, health care, public health, disease dynamics, political (domestic), political (international), and economic. Countries are scored between 0-1, with higher scores representing greater capacity to respond to outbreaks. Table 1 [available at source links] outlines the top 20 destination cities with passengers arriving from Wuhan; Bangkok, Hong Kong, Tokyo, and Taipei received the largest volumes with 41 080, 23 707, 20 001, and 17 645 arrivals between January and March [2018], respectively. The IDVI for these leading destinations all exceed 0.65. Sydney and Victoria, Australia, and Dubai, UAE are the only 3 cities in the top 20 destinations that are outside of Asia. Bali, Indonesia has the lowest IDVI score (0.563) in the top 20 destination cities. Fortunately, most countries receiving the largest volumes of passengers from Wuhan, China appear to have high IDVI scores, corresponding to relatively strong public health and healthcare capacity." -- Communicated by: ProMED-mail <[email protected]> [This article is a very interesting analysis of the easily identifiable high-risk locations for importation of cases from Wuhan. The table is enlightening both in terms of the amount of airplane traffic in a 3-month period between Wuhan city and other countries, as well as the apparent public health capacity of the Asian countries that will potentially be receiving cases if this outbreak continues and expands its geographic locations. - Mod.MPP] See Also Novel coronavirus (03): China (HU) animal reservoir suggested, RFI 20200114.6887480 Novel coronavirus (02): Thailand ex China (HU) WHO 20200113.6886644 Novel coronavirus (01): China (HU) WHO, phylogenetic tree 20200112.6885385 Undiagnosed pneumonia - China (HU) (10): genome available, Hong Kong surveill. 20200111.6883998 Undiagnosed pneumonia - China (HU) (09): novel coronavirus, more info, fatality 20200110.6883253 Undiagnosed pneumonia - China (HU) (08): novel coronavirus, WHO 20200110.6881082 Undiagnosed pneumonia - China (HU) (07): official confirmation of novel coronavirus 20200108.6878869 Undiagnosed pneumonia - China (06): (HU) Hong Kong surveillance, USA CDC alert 20200108.6876648 Undiagnosed pneumonia - China (05): (HU) novel coronavirus identified 20200108.6877694 Undiagnosed pneumonia - China (04): (HU) Hong Kong surveillance 20200106.6874277 Undiagnosed pneumonia - China (03): (HU) updates, SARS, MERS ruled out, WHO, RFI 20200105.6872267 Undiagnosed pneumonia - China (02): (HU) updates, other country responses, RFI 20200103.6869668 Undiagnosed pneumonia - China (01): (HU) wildlife sales, market closed, RFI 20200102.6866757 2019 ---- Undiagnosed pneumonia - China: (HU) RFI 20191230.6864153 .................................................mpp/msp/lm/msp/jh -
Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1, complete genome GenBank: MN908947.2 FASTA Graphics Go to: LOCUS MN908947 29875 bp ss-RNA linear VRL 14-JAN-2020 DEFINITION Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1, complete genome. ACCESSION MN908947 VERSION MN908947.2 KEYWORDS . SOURCE Wuhan seafood market pneumonia virus ORGANISM Wuhan seafood market pneumonia virus Viruses; Riboviria; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; unclassified Betacoronavirus. REFERENCE 1 (bases 1 to 29875) AUTHORS Zhang,Y.-Z., Wu,F., Chen,Y.-M., Pei,Y.-Y., Xu,L., Wang,W., Zhao,S., Yu,B., Hu,Y., Tao,Z.-W., Song,Z.-G., Tian,J.-H., Zhang,Y.-L., Liu,Y., Zheng,J.-J., Dai,F.-H., Wang,Q.-M., She,J.-L. and Zhu,T.-Y. TITLE A novel coronavirus associated with a respiratory disease in Wuhan of Hubei province, China JOURNAL Unpublished REFERENCE 2 (bases 1 to 29875) AUTHORS Zhang,Y.-Z., Wu,F., Chen,Y.-M., Pei,Y.-Y., Xu,L., Wang,W., Zhao,S., Yu,B., Hu,Y., Tao,Z.-W., Song,Z.-G., Tian,J.-H., Zhang,Y.-L., Liu,Y., Zheng,J.-J., Dai,F.-H., Wang,Q.-M., She,J.-L. and Zhu,T.-Y. TITLE Direct Submission JOURNAL Submitted (05-JAN-2020) Department of Zoonoses, National Institute of Communicable Disease Control and Prevention, Chinese Center for Disease Control and Prevention, Changping Liuzi 5, Beijing 102206, China COMMENT On Jan 14, 2020 this sequence version replaced MN908947.1. ##Assembly-Data-START## Assembly Method :: Megahit v. V1.1.3 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..29875 /organism="Wuhan seafood market pneumonia virus" /mol_type="genomic RNA" /isolate="Wuhan-Hu-1" /host="Homo sapiens" /db_xref="taxon:2697049" /country="China" /collection_date="Dec-2019" 5'UTR 1..281 gene 282..21571 /gene="orf1ab" CDS join(282..13484,13484..21571) /gene="orf1ab" /ribosomal_slippage /note="pp1ab; translated by -1 ribosomal frameshift" /codon_start=1 /product="ORF1ab polyprotein" /protein_id="QHD43415.1" /translation="MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQ HLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGE TLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN WNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQ LDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFP LNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTG DFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESG LKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN FKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAA ITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKL KPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLV NKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEII FLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEK YCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEK CSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEF KLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPE EEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSG YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESD DYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLA PLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIA EIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGN LHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREM LAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLIN TLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS KTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVIT FDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPH NSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIK WADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELG DVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ IPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSK ETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYY KKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVT FFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWST KPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGD IILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNS VPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRI KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTA ALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLET IQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWL MWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVE CTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRP INPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPI NVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVN TFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVEC LKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALI WNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWL KQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFA NKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLP RVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVA YESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSG RWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTN DVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFE EAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL AKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVL KLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSC GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAV LDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHW LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFL LPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTAR TVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLAR GIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYL VSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVL LSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKL CEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAK SEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALN NIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDA DSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTA CTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTP KGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAK AYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDH PNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA DAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKD EDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQR LTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYA NLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVV DSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQ TYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRE LGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDI RQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQ DALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAAT RGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLAR KHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQ AVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMM ILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCS QHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKH PNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTV LQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCD VTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDW TNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKP RPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSH TVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGK SHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKF KVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQ LPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLK AHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNA VASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSD RDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT EGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEG CHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIP LMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCL CDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNA HVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADK FPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCL FWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQ LPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYN MMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIINNT VYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDY KRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEG SVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFK PRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESP FELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKV TIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGD SATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLP TGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEG FFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFL IGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKE GQINDMILSLLSKGRLIIRENNRVVISSDVLVNN" gene 21579..25400 /gene="S" CDS 21579..25400 /gene="S" /note="structural protein" /codon_start=1 /product="surface glycoprotein" /protein_id="QHD43416.1" /translation="MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFR SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIR GWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQ GFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFL LKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITN LCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCF TNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPY RVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFG RDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAI HADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR RARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTM YICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFG GFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFN GLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQN VLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGA ISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMS ECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAH FPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELG KYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE PVLKGVKLHYT" gene 25409..26236 /gene="ORF3" CDS 25409..26236 /gene="ORF3" /codon_start=1 /product="ORF3 protein" /protein_id="QHD43417.1" /translation="MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFG WLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLE APFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPY NSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQ LSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL" gene 26261..26488 /gene="E" CDS 26261..26488 /gene="E" /note="structural protein; E protein" /codon_start=1 /product="envelope protein" /protein_id="QHD43418.1" /translation="MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV" gene 26539..27207 /gene="M" CDS 26539..27207 /gene="M" /note="structural protein" /codon_start=1 /product="membrane glycoprotein" /protein_id="QHD43419.1" /translation="MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNR FLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRL FARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCD IKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIA LLVQ" gene 27218..27403 /gene="ORF6" CDS 27218..27403 /gene="ORF6" /codon_start=1 /product="ORF6 protein" /protein_id="QHD43420.1" /translation="MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSL TENKYSQLDEEQPMEID" gene 27410..27775 /gene="ORF7" CDS 27410..27775 /gene="ORF7" /codon_start=1 /product="ORF7 protein" /protein_id="QHD43421.1" /translation="MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNS PFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFL IVAAIVFITLCFTLKRKTE" gene 27910..28275 /gene="ORF8" CDS 27910..28275 /gene="ORF8" /codon_start=1 /product="ORF8 protein" /protein_id="QHD43422.1" /translation="MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSK WYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRC SFYEDFLEYHDVRVVLDFI" gene 28290..29549 /gene="N" CDS 28290..29549 /gene="N" /note="structural protein" /codon_start=1 /product="nucleocapsid phosphoprotein" /protein_id="QHD43423.1" /translation="MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQG LPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMK DLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAA LALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGR RGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT AAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTV TLLPAADLDDFSKQLQQSMSSADSTQA" 3'UTR 29550..29875 ORIGIN 1 cggtgacgca tacaaaacat tcccaccata ccttcccagg taacaaacca accaactttc 61 gatctcttgt agatctgttc tctaaacgaa ctttaaaatc tgtgtggctg tcactcggct 121 gcatgcttag tgcactcacg cagtataatt aataactaat tactgtcgtt gacaggacac 181 gagtaactcg tctatcttct gcaggctgct tacggtttcg tccgtgttgc agccgatcat 241 cagcacatct aggtttcgtc cgggtgtgac cgaaaggtaa gatggagagc cttgtccctg 301 gtttcaacga gaaaacacac gtccaactca gtttgcctgt tttacaggtt cgcgacgtgc 361 tcgtacgtgg ctttggagac tccgtggagg aggtcttatc agaggcacgt caacatctta 421 aagatggcac ttgtggctta gtagaagttg aaaaaggcgt tttgcctcaa cttgaacagc 481 cctatgtgtt catcaaacgt tcggatgctc gaactgcacc tcatggtcat gttatggttg 541 agctggtagc agaactcgaa ggcattcagt acggtcgtag tggtgagaca cttggtgtcc 601 ttgtccctca tgtgggcgaa ataccagtgg cttaccgcaa ggttcttctt cgtaagaacg 661 gtaataaagg agctggtggc catagttacg gcgccgatct aaagtcattt gacttaggcg 721 acgagcttgg cactgatcct tatgaagatt ttcaagaaaa ctggaacact aaacatagca 781 gtggtgttac ccgtgaactc atgcgtgagc ttaacggagg ggcatacact cgctatgtcg 841 ataacaactt ctgtggccct gatggctacc ctcttgagtg cattaaagac cttctagcac 901 gtgctggtaa agcttcatgc actttgtccg aacaactgga ctttattgac actaagaggg 961 gtgtatactg ctgccgtgaa catgagcatg aaattgcttg gtacacggaa cgttctgaaa 1021 agagctatga attgcagaca ccttttgaaa ttaaattggc aaagaaattt gacaccttca 1081 atggggaatg tccaaatttt gtatttccct taaattccat aatcaagact attcaaccaa 1141 gggttgaaaa gaaaaagctt gatggcttta tgggtagaat tcgatctgtc tatccagttg 1201 cgtcaccaaa tgaatgcaac caaatgtgcc tttcaactct catgaagtgt gatcattgtg 1261 gtgaaacttc atggcagacg ggcgattttg ttaaagccac ttgcgaattt tgtggcactg 1321 agaatttgac taaagaaggt gccactactt gtggttactt accccaaaat gctgttgtta 1381 aaatttattg tccagcatgt cacaattcag aagtaggacc tgagcatagt cttgccgaat 1441 accataatga atctggcttg aaaaccattc ttcgtaaggg tggtcgcact attgcctttg 1501 gaggctgtgt gttctcttat gttggttgcc ataacaagtg tgcctattgg gttccacgtg 1561 ctagcgctaa cataggttgt aaccatacag gtgttgttgg agaaggttcc gaaggtctta 1621 atgacaacct tcttgaaata ctccaaaaag agaaagtcaa catcaatatt gttggtgact 1681 ttaaacttaa tgaagagatc gccattattt tggcatcttt ttctgcttcc acaagtgctt 1741 ttgtggaaac tgtgaaaggt ttggattata aagcattcaa acaaattgtt gaatcctgtg 1801 gtaattttaa agttacaaaa ggaaaagcta aaaaaggtgc ctggaatatt ggtgaacaga 1861 aatcaatact gagtcctctt tatgcatttg catcagaggc tgctcgtgtt gtacgatcaa 1921 ttttctcccg cactcttgaa actgctcaaa attctgtgcg tgttttacag aaggccgcta 1981 taacaatact agatggaatt tcacagtatt cactgagact cattgatgct atgatgttca 2041 catctgattt ggctactaac aatctagttg taatggccta cattacaggt ggtgttgttc 2101 agttgacttc gcagtggcta actaacatct ttggcactgt ttatgaaaaa ctcaaacccg 2161 tccttgattg gcttgaagag aagtttaagg aaggtgtaga gtttcttaga gacggttggg 2221 aaattgttaa atttatctca acctgtgctt gtgaaattgt cggtggacaa attgtcacct 2281 gtgcaaagga aattaaggag agtgttcaga cattctttaa gcttgtaaat aaatttttgg 2341 ctttgtgtgc tgactctatc attattggtg gagctaaact taaagccttg aatttaggtg 2401 aaacatttgt cacgcactca aagggattgt acagaaagtg tgttaaatcc agagaagaaa 2461 ctggcctact catgcctcta aaagccccaa aagaaattat cttcttagag ggagaaacac 2521 ttcccacaga agtgttaaca gaggaagttg tcttgaaaac tggtgattta caaccattag 2581 aacaacctac tagtgaagct gttgaagctc cattggttgg tacaccagtt tgtattaacg 2641 ggcttatgtt gctcgaaatc aaagacacag aaaagtactg tgcccttgca cctaatatga 2701 tggtaacaaa caataccttc acactcaaag gcggtgcacc aacaaaggtt acttttggtg 2761 atgacactgt gatagaagtg caaggttaca agagtgtgaa tatcactttt gaacttgatg 2821 aaaggattga taaagtactt aatgagaagt gctctgccta tacagttgaa ctcggtacag 2881 aagtaaatga gttcgcctgt gttgtggcag atgctgtcat aaaaactttg caaccagtat 2941 ctgaattact tacaccactg ggcattgatt tagatgagtg gagtatggct acatactact 3001 tatttgatga gtctggtgag tttaaattgg cttcacatat gtattgttct ttctaccctc 3061 cagatgagga tgaagaagaa ggtgattgtg aagaagaaga gtttgagcca tcaactcaat 3121 atgagtatgg tactgaagat gattaccaag gtaaaccttt ggaatttggt gccacttctg 3181 ctgctcttca acctgaagaa gagcaagaag aagattggtt agatgatgat agtcaacaaa 3241 ctgttggtca acaagacggc agtgaggaca atcagacaac tactattcaa acaattgttg 3301 aggttcaacc tcaattagag atggaactta caccagttgt tcagactatt gaagtgaata 3361 gttttagtgg ttatttaaaa cttactgaca atgtatacat taaaaatgca gacattgtgg 3421 aagaagctaa aaaggtaaaa ccaacagtgg ttgttaatgc agccaatgtt taccttaaac 3481 atggaggagg tgttgcagga gccttaaata aggctactaa caatgccatg caagttgaat 3541 ctgatgatta catagctact aatggaccac ttaaagtggg tggtagttgt gttttaagcg 3601 gacacaatct tgctaaacac tgtcttcatg ttgtcggccc aaatgttaac aaaggtgaag 3661 acattcaact tcttaagagt gcttatgaaa attttaatca gcacgaagtt ctacttgcac 3721 cattattatc agctggtatt tttggtgctg accctataca ttctttaaga gtttgtgtag 3781 atactgttcg cacaaatgtc tacttagctg tctttgataa aaatctctat gacaaacttg 3841 tttcaagctt tttggaaatg aagagtgaaa agcaagttga acaaaagatc gctgagattc 3901 ctaaagagga agttaagcca tttataactg aaagtaaacc ttcagttgaa cagagaaaac 3961 aagatgataa gaaaatcaaa gcttgtgttg aagaagttac aacaactctg gaagaaacta 4021 agttcctcac agaaaacttg ttactttata ttgacattaa tggcaatctt catccagatt 4081 ctgccactct tgttagtgac attgacatca ctttcttaaa gaaagatgct ccatatatag 4141 tgggtgatgt tgttcaagag ggtgttttaa ctgctgtggt tatacctact aaaaaggctg 4201 gtggcactac tgaaatgcta gcgaaagctt tgagaaaagt gccaacagac aattatataa 4261 ccacttaccc gggtcagggt ttaaatggtt acactgtaga ggaggcaaag acagtgctta 4321 aaaagtgtaa aagtgccttt tacattctac catctattat ctctaatgag aagcaagaaa 4381 ttcttggaac tgtttcttgg aatttgcgag aaatgcttgc acatgcagaa gaaacacgca 4441 aattaatgcc tgtctgtgtg gaaactaaag ccatagtttc aactatacag cgtaaatata 4501 agggtattaa aatacaagag ggtgtggttg attatggtgc tagattttac ttttacacca 4561 gtaaaacaac tgtagcgtca cttatcaaca cacttaacga tctaaatgaa actcttgtta 4621 caatgccact tggctatgta acacatggct taaatttgga agaagctgct cggtatatga 4681 gatctctcaa agtgccagct acagtttctg tttcttcacc tgatgctgtt acagcgtata 4741 atggttatct tacttcttct tctaaaacac ctgaagaaca ttttattgaa accatctcac 4801 ttgctggttc ctataaagat tggtcctatt ctggacaatc tacacaacta ggtatagaat 4861 ttcttaagag aggtgataaa agtgtatatt acactagtaa tcctaccaca ttccacctag 4921 atggtgaagt tatcaccttt gacaatctta agacacttct ttctttgaga gaagtgagga 4981 ctattaaggt gtttacaaca gtagacaaca ttaacctcca cacgcaagtt gtggacatgt 5041 caatgacata tggacaacag tttggtccaa cttatttgga tggagctgat gttactaaaa 5101 taaaacctca taattcacat gaaggtaaaa cattttatgt tttacctaat gatgacactc 5161 tacgtgttga ggcttttgag tactaccaca caactgatcc tagttttctg ggtaggtaca 5221 tgtcagcatt aaatcacact aaaaagtgga aatacccaca agttaatggt ttaacttcta 5281 ttaaatgggc agataacaac tgttatcttg ccactgcatt gttaacactc caacaaatag 5341 agttgaagtt taatccacct gctctacaag atgcttatta cagagcaagg gctggtgaag 5401 ctgctaactt ttgtgcactt atcttagcct actgtaataa gacagtaggt gagttaggtg 5461 atgttagaga aacaatgagt tacttgtttc aacatgccaa tttagattct tgcaaaagag 5521 tcttgaacgt ggtgtgtaaa acttgtggac aacagcagac aacccttaag ggtgtagaag 5581 ctgttatgta catgggcaca ctttcttatg aacaatttaa gaaaggtgtt cagatacctt 5641 gtacgtgtgg taaacaagct acaaaatatc tagtacaaca ggagtcacct tttgttatga 5701 tgtcagcacc acctgctcag tatgaactta agcatggtac atttacttgt gctagtgagt 5761 acactggtaa ttaccagtgt ggtcactata aacatataac ttctaaagaa actttgtatt 5821 gcatagacgg tgctttactt acaaagtcct cagaatacaa aggtcctatt acggatgttt 5881 tctacaaaga aaacagttac acaacaacca taaaaccagt tacttataaa ttggatggtg 5941 ttgtttgtac agaaattgac cctaagttgg acaattatta taagaaagac aattcttatt 6001 tcacagagca accaattgat cttgtaccaa accaaccata tccaaacgca agcttcgata 6061 attttaagtt tgtatgtgat aatatcaaat ttgctgatga tttaaaccag ttaactggtt 6121 ataagaaacc tgcttcaaga gagcttaaag ttacattttt ccctgactta aatggtgatg 6181 tggtggctat tgattataaa cactacacac cctcttttaa gaaaggagct aaattgttac 6241 ataaacctat tgtttggcat gttaacaatg caactaataa agccacgtat aaaccaaata 6301 cctggtgtat acgttgtctt tggagcacaa aaccagttga aacatcaaat tcgtttgatg 6361 tactgaagtc agaggacgcg cagggaatgg ataatcttgc ctgcgaagat ctaaaaccag 6421 tctctgaaga agtagtggaa aatcctacca tacagaaaga cgttcttgag tgtaatgtga 6481 aaactaccga agttgtagga gacattatac ttaaaccagc aaataatagt ttaaaaatta 6541 cagaagaggt tggccacaca gatctaatgg ctgcttatgt agacaattct agtcttacta 6601 ttaagaaacc taatgaatta tctagagtat taggtttgaa aacccttgct actcatggtt 6661 tagctgctgt taatagtgtc ccttgggata ctatagctaa ttatgctaag ccttttctta 6721 acaaagttgt tagtacaact actaacatag ttacacggtg tttaaaccgt gtttgtacta 6781 attatatgcc ttatttcttt actttattgc tacaattgtg tacttttact agaagtacaa 6841 attctagaat taaagcatct atgccgacta ctatagcaaa gaatactgtt aagagtgtcg 6901 gtaaattttg tctagaggct tcatttaatt atttgaagtc acctaatttt tctaaactga 6961 taaatattat aatttggttt ttactattaa gtgtttgcct aggttcttta atctactcaa 7021 ccgctgcttt aggtgtttta atgtctaatt taggcatgcc ttcttactgt actggttaca 7081 gagaaggcta tttgaactct actaatgtca ctattgcaac ctactgtact ggttctatac 7141 cttgtagtgt ttgtcttagt ggtttagatt ctttagacac ctatccttct ttagaaacta 7201 tacaaattac catttcatct tttaaatggg atttaactgc ttttggctta gttgcagagt 7261 ggtttttggc atatattctt ttcactaggt ttttctatgt acttggattg gctgcaatca 7321 tgcaattgtt tttcagctat tttgcagtac attttattag taattcttgg cttatgtggt 7381 taataattaa tcttgtacaa atggccccga tttcagctat ggttagaatg tacatcttct 7441 ttgcatcatt ttattatgta tggaaaagtt atgtgcatgt tgtagacggt tgtaattcat 7501 caacttgtat gatgtgttac aaacgtaata gagcaacaag agtcgaatgt acaactattg 7561 ttaatggtgt tagaaggtcc ttttatgtct atgctaatgg aggtaaaggc ttttgcaaac 7621 tacacaattg gaattgtgtt aattgtgata cattctgtgc tggtagtaca tttattagtg 7681 atgaagttgc gagagacttg tcactacagt ttaaaagacc aataaatcct actgaccagt 7741 cttcttacat cgttgatagt gttacagtga agaatggttc catccatctt tactttgata 7801 aagctggtca aaagacttat gaaagacatt ctctctctca ttttgttaac ttagacaacc 7861 tgagagctaa taacactaaa ggttcattgc ctattaatgt tatagttttt gatggtaaat 7921 caaaatgtga agaatcatct gcaaaatcag cgtctgttta ctacagtcag cttatgtgtc 7981 aacctatact gttactagat caggcattag tgtctgatgt tggtgatagt gcggaagttg 8041 cagttaaaat gtttgatgct tacgttaata cgttttcatc aacttttaac gtaccaatgg 8101 aaaaactcaa aacactagtt gcaactgcag aagctgaact tgcaaagaat gtgtccttag 8161 acaatgtctt atctactttt atttcagcag ctcggcaagg gtttgttgat tcagatgtag 8221 aaactaaaga tgttgttgaa tgtcttaaat tgtcacatca atctgacata gaagttactg 8281 gcgatagttg taataactat atgctcacct ataacaaagt tgaaaacatg acaccccgtg 8341 accttggtgc ttgtattgac tgtagtgcgc gtcatattaa tgcgcaggta gcaaaaagtc 8401 acaacattgc tttgatatgg aacgttaaag atttcatgtc attgtctgaa caactacgaa 8461 aacaaatacg tagtgctgct aaaaagaata acttaccttt taagttgaca tgtgcaacta 8521 ctagacaagt tgttaatgtt gtaacaacaa agatagcact taagggtggt aaaattgtta 8581 ataattggtt gaagcagtta attaaagtta cacttgtgtt cctttttgtt gctgctattt 8641 tctatttaat aacacctgtt catgtcatgt ctaaacatac tgacttttca agtgaaatca 8701 taggatacaa ggctattgat ggtggtgtca ctcgtgacat agcatctaca gatacttgtt 8761 ttgctaacaa acatgctgat tttgacacat ggtttagcca gcgtggtggt agttatacta 8821 atgacaaagc ttgcccattg attgctgcag tcataacaag agaagtgggt tttgtcgtgc 8881 ctggtttgcc tggcacgata ttacgcacaa ctaatggtga ctttttgcat ttcttaccta 8941 gagtttttag tgcagttggt aacatctgtt acacaccatc aaaacttata gagtacactg 9001 actttgcaac atcagcttgt gttttggctg ctgaatgtac aatttttaaa gatgcttctg 9061 gtaagccagt accatattgt tatgatacca atgtactaga aggttctgtt gcttatgaaa 9121 gtttacgccc tgacacacgt tatgtgctca tggatggctc tattattcaa tttcctaaca 9181 cctaccttga aggttctgtt agagtggtaa caacttttga ttctgagtac tgtaggcacg 9241 gcacttgtga aagatcagaa gctggtgttt gtgtatctac tagtggtaga tgggtactta 9301 acaatgatta ttacagatct ttaccaggag ttttctgtgg tgtagatgct gtaaatttac 9361 ttactaatat gtttacacca ctaattcaac ctattggtgc tttggacata tcagcatcta 9421 tagtagctgg tggtattgta gctatcgtag taacatgcct tgcctactat tttatgaggt 9481 ttagaagagc ttttggtgaa tacagtcatg tagttgcctt taatacttta ctattcctta 9541 tgtcattcac tgtactctgt ttaacaccag tttactcatt cttacctggt gtttattctg 9601 ttatttactt gtacttgaca ttttatctta ctaatgatgt ttctttttta gcacatattc 9661 agtggatggt tatgttcaca cctttagtac ctttctggat aacaattgct tatatcattt 9721 gtatttccac aaagcatttc tattggttct ttagtaatta cctaaagaga cgtgtagtct 9781 ttaatggtgt ttcctttagt acttttgaag aagctgcgct gtgcaccttt ttgttaaata 9841 aagaaatgta tctaaagttg cgtagtgatg tgctattacc tcttacgcaa tataatagat 9901 acttagctct ttataataag tacaagtatt ttagtggagc aatggataca actagctaca 9961 gagaagctgc ttgttgtcat ctcgcaaagg ctctcaatga cttcagtaac tcaggttctg 10021 atgttcttta ccaaccacca caaacctcta tcacctcagc tgttttgcag agtggtttta 10081 gaaaaatggc attcccatct ggtaaagttg agggttgtat ggtacaagta acttgtggta 10141 caactacact taacggtctt tggcttgatg acgtagttta ctgtccaaga catgtgatct 10201 gcacctctga agacatgctt aaccctaatt atgaagattt actcattcgt aagtctaatc 10261 ataatttctt ggtacaggct ggtaatgttc aactcagggt tattggacat tctatgcaaa 10321 attgtgtact taagcttaag gttgatacag ccaatcctaa gacacctaag tataagtttg 10381 ttcgcattca accaggacag actttttcag tgttagcttg ttacaatggt tcaccatctg 10441 gtgtttacca atgtgctatg aggcccaatt tcactattaa gggttcattc cttaatggtt 10501 catgtggtag tgttggtttt aacatagatt atgactgtgt ctctttttgt tacatgcacc 10561 atatggaatt accaactgga gttcatgctg gcacagactt agaaggtaac ttttatggac 10621 cttttgttga caggcaaaca gcacaagcag ctggtacgga cacaactatt acagttaatg 10681 ttttagcttg gttgtacgct gctgttataa atggagacag gtggtttctc aatcgattta 10741 ccacaactct taatgacttt aaccttgtgg ctatgaagta caattatgaa cctctaacac 10801 aagaccatgt tgacatacta ggacctcttt ctgctcaaac tggaattgcc gttttagata 10861 tgtgtgcttc attaaaagaa ttactgcaaa atggtatgaa tggacgtacc atattgggta 10921 gtgctttatt agaagatgaa tttacacctt ttgatgttgt tagacaatgc tcaggtgtta 10981 ctttccaaag tgcagtgaaa agaacaatca agggtacaca ccactggttg ttactcacaa 11041 ttttgacttc acttttagtt ttagtccaga gtactcaatg gtctttgttc ttttttttgt 11101 atgaaaatgc ctttttacct tttgctatgg gtattattgc tatgtctgct tttgcaatga 11161 tgtttgtcaa acataagcat gcatttctct gtttgttttt gttaccttct cttgccactg 11221 tagcttattt taatatggtc tatatgcctg ctagttgggt gatgcgtatt atgacatggt 11281 tggatatggt tgatactagt ttgtctggtt ttaagctaaa agactgtgtt atgtatgcat 11341 cagctgtagt gttactaatc cttatgacag caagaactgt gtatgatgat ggtgctagga 11401 gagtgtggac acttatgaat gtcttgacac tcgtttataa agtttattat ggtaatgctt 11461 tagatcaagc catttccatg tgggctctta taatctctgt tacttctaac tactcaggtg 11521 tagttacaac tgtcatgttt ttggccagag gtattgtttt tatgtgtgtt gagtattgcc 11581 ctattttctt cataactggt aatacacttc agtgtataat gctagtttat tgtttcttag 11641 gctatttttg tacttgttac tttggcctct tttgtttact caaccgctac tttagactga 11701 ctcttggtgt ttatgattac ttagtttcta cacaggagtt tagatatatg aattcacagg 11761 gactactccc acccaagaat agcatagatg ccttcaaact caacattaaa ttgttgggtg 11821 ttggtggcaa accttgtatc aaagtagcca ctgtacagtc taaaatgtca gatgtaaagt 11881 gcacatcagt agtcttactc tcagttttgc aacaactcag agtagaatca tcatctaaat 11941 tgtgggctca atgtgtccag ttacacaatg acattctctt agctaaagat actactgaag 12001 cctttgaaaa aatggtttca ctactttctg ttttgctttc catgcagggt gctgtagaca 12061 taaacaagct ttgtgaagaa atgctggaca acagggcaac cttacaagct atagcctcag 12121 agtttagttc ccttccatca tatgcagctt ttgctactgc tcaagaagct tatgagcagg 12181 ctgttgctaa tggtgattct gaagttgttc ttaaaaagtt gaagaagtct ttgaatgtgg 12241 ctaaatctga atttgaccgt gatgcagcca tgcaacgtaa gttggaaaag atggctgatc 12301 aagctatgac ccaaatgtat aaacaggcta gatctgagga caagagggca aaagttacta 12361 gtgctatgca gacaatgctt ttcactatgc ttagaaagtt ggataatgat gcactcaaca 12421 acattatcaa caatgcaaga gatggttgtg ttcccttgaa cataatacct cttacaacag 12481 cagccaaact aatggttgtc ataccagact ataacacata taaaaatacg tgtgatggta 12541 caacatttac ttatgcatca gcattgtggg aaatccaaca ggttgtagat gcagatagta 12601 aaattgttca acttagtgaa attagtatgg acaattcacc taatttagca tggcctctta 12661 ttgtaacagc tttaagggcc aattctgctg tcaaattaca gaataatgag cttagtcctg 12721 ttgcactacg acagatgtct tgtgctgccg gtactacaca aactgcttgc actgatgaca 12781 atgcgttagc ttactacaac acaacaaagg gaggtaggtt tgtacttgca ctgttatccg 12841 atttacagga tttgaaatgg gctagattcc ctaagagtga tggaactggt actatctata 12901 cagaactgga accaccttgt aggtttgtta cagacacacc taaaggtcct aaagtgaagt 12961 atttatactt tattaaagga ttaaacaacc taaatagagg tatggtactt ggtagtttag 13021 ctgccacagt acgtctacaa gctggtaatg caacagaagt gcctgccaat tcaactgtat 13081 tatctttctg tgcttttgct gtagatgctg ctaaagctta caaagattat ctagctagtg 13141 ggggacaacc aatcactaat tgtgttaaga tgttgtgtac acacactggt actggtcagg 13201 caataacagt tacaccggaa gccaatatgg atcaagaatc ctttggtggt gcatcgtgtt 13261 gtctgtactg ccgttgccac atagatcatc caaatcctaa aggattttgt gacttaaaag 13321 gtaagtatgt acaaatacct acaacttgtg ctaatgaccc tgtgggtttt acacttaaaa 13381 acacagtctg taccgtctgc ggtatgtgga aaggttatgg ctgtagttgt gatcaactcc 13441 gcgaacccat gcttcagtca gctgatgcac aatcgttttt aaacgggttt gcggtgtaag 13501 tgcagcccgt cttacaccgt gcggcacagg cactagtact gatgtcgtat acagggcttt 13561 tgacatctac aatgataaag tagctggttt tgctaaattc ctaaaaacta attgttgtcg 13621 cttccaagaa aaggacgaag atgacaattt aattgattct tactttgtag ttaagagaca 13681 cactttctct aactaccaac atgaagaaac aatttataat ttacttaagg attgtccagc 13741 tgttgctaaa catgacttct ttaagtttag aatagacggt gacatggtac cacatatatc 13801 acgtcaacgt cttactaaat acacaatggc agacctcgtc tatgctttaa ggcattttga 13861 tgaaggtaat tgtgacacat taaaagaaat acttgtcaca tacaattgtt gtgatgatga 13921 ttatttcaat aaaaaggact ggtatgattt tgtagaaaac ccagatatat tacgcgtata 13981 cgccaactta ggtgaacgtg tacgccaagc tttgttaaaa acagtacaat tctgtgatgc 14041 catgcgaaat gctggtattg ttggtgtact gacattagat aatcaagatc tcaatggtaa 14101 ctggtatgat ttcggtgatt tcatacaaac cacgccaggt agtggagttc ctgttgtaga 14161 ttcttattat tcattgttaa tgcctatatt aaccttgacc agggctttaa ctgcagagtc 14221 acatgttgac actgacttaa caaagcctta cattaagtgg gatttgttaa aatatgactt 14281 cacggaagag aggttaaaac tctttgaccg ttattttaaa tattgggatc agacatacca 14341 cccaaattgt gttaactgtt tggatgacag atgcattctg cattgtgcaa actttaatgt 14401 tttattctct acagtgttcc cacctacaag ttttggacca ctagtgagaa aaatatttgt 14461 tgatggtgtt ccatttgtag tttcaactgg ataccacttc agagagctag gtgttgtaca 14521 taatcaggat gtaaacttac atagctctag acttagtttt aaggaattac ttgtgtatgc 14581 tgctgaccct gctatgcacg ctgcttctgg taatctatta ctagataaac gcactacgtg 14641 cttttcagta gctgcactta ctaacaatgt tgcttttcaa actgtcaaac ccggtaattt 14701 taacaaagac ttctatgact ttgctgtgtc taagggtttc tttaaggaag gaagttctgt 14761 tgaattaaaa cacttcttct ttgctcagga tggtaatgct gctatcagcg attatgacta 14821 ctatcgttat aatctaccaa caatgtgtga tatcagacaa ctactatttg tagttgaagt 14881 tgttgataag tactttgatt gttacgatgg tggctgtatt aatgctaacc aagtcatcgt 14941 caacaaccta gacaaatcag ctggttttcc atttaataaa tggggtaagg ctagacttta 15001 ttatgattca atgagttatg aggatcaaga tgcacttttc gcatatacaa aacgtaatgt 15061 catccctact ataactcaaa tgaatcttaa gtatgccatt agtgcaaaga atagagctcg 15121 caccgtagct ggtgtctcta tctgtagtac tatgaccaat agacagtttc atcaaaaatt 15181 attgaaatca atagccgcca ctagaggagc tactgtagta attggaacaa gcaaattcta 15241 tggtggttgg cacaacatgt taaaaactgt ttatagtgat gtagaaaacc ctcaccttat 15301 gggttgggat tatcctaaat gtgatagagc catgcctaac atgcttagaa ttatggcctc 15361 acttgttctt gctcgcaaac atacaacgtg ttgtagcttg tcacaccgtt tctatagatt 15421 agctaatgag tgtgctcaag tattgagtga aatggtcatg tgtggcggtt cactatatgt 15481 taaaccaggt ggaacctcat caggagatgc cacaactgct tatgctaata gtgtttttaa 15541 catttgtcaa gctgtcacgg ccaatgttaa tgcactttta tctactgatg gtaacaaaat 15601 tgccgataag tatgtccgca atttacaaca cagactttat gagtgtctct atagaaatag 15661 agatgttgac acagactttg tgaatgagtt ttacgcatat ttgcgtaaac atttctcaat 15721 gatgatactc tctgacgatg ctgttgtgtg tttcaatagc acttatgcat ctcaaggtct 15781 agtggctagc ataaagaact ttaagtcagt tctttattat caaaacaatg tttttatgtc 15841 tgaagcaaaa tgttggactg agactgacct tactaaagga cctcatgaat tttgctctca 15901 acatacaatg ctagttaaac agggtgatga ttatgtgtac cttccttacc cagatccatc 15961 aagaatccta ggggccggct gttttgtaga tgatatcgta aaaacagatg gtacacttat 16021 gattgaacgg ttcgtgtctt tagctataga tgcttaccca cttactaaac atcctaatca 16081 ggagtatgct gatgtctttc atttgtactt acaatacata agaaagctac atgatgagtt 16141 aacaggacac atgttagaca tgtattctgt tatgcttact aatgataaca cttcaaggta 16201 ttgggaacct gagttttatg aggctatgta cacaccgcat acagtcttac aggctgttgg 16261 ggcttgtgtt ctttgcaatt cacagacttc attaagatgt ggtgcttgca tacgtagacc 16321 attcttatgt tgtaaatgct gttacgacca tgtcatatca acatcacata aattagtctt 16381 gtctgttaat ccgtatgttt gcaatgctcc aggttgtgat gtcacagatg tgactcaact 16441 ttacttagga ggtatgagct attattgtaa atcacataaa ccacccatta gttttccatt 16501 gtgtgctaat ggacaagttt ttggtttata taaaaataca tgtgttggta gcgataatgt 16561 tactgacttt aatgcaattg caacatgtga ctggacaaat gctggtgatt acattttagc 16621 taacacctgt actgaaagac tcaagctttt tgcagcagaa acgctcaaag ctactgagga 16681 gacatttaaa ctgtcttatg gtattgctac tgtacgtgaa gtgctgtctg acagagaatt 16741 acatctttca tgggaagttg gtaaacctag accaccactt aaccgaaatt atgtctttac 16801 tggttatcgt gtaactaaaa acagtaaagt acaaatagga gagtacacct ttgaaaaagg 16861 tgactatggt gatgctgttg tttaccgagg tacaacaact tacaaattaa atgttggtga 16921 ttattttgtg ctgacatcac atacagtaat gccattaagt gcacctacac tagtgccaca 16981 agagcactat gttagaatta ctggcttata cccaacactc aatatctcag atgagttttc 17041 tagcaatgtt gcaaattatc aaaaggttgg tatgcaaaag tattctacac tccagggacc 17101 acctggtact ggtaagagtc attttgctat tggcctagct ctctactacc cttctgctcg 17161 catagtgtat acagcttgct ctcatgccgc tgttgatgca ctatgtgaga aggcattaaa 17221 atatttgcct atagataaat gtagtagaat tatacctgca cgtgctcgtg tagagtgttt 17281 tgataaattc aaagtgaatt caacattaga acagtatgtc ttttgtactg taaatgcatt 17341 gcctgagacg acagcagata tagttgtctt tgatgaaatt tcaatggcca caaattatga 17401 tttgagtgtt gtcaatgcca gattacgtgc taagcactat gtgtacattg gcgaccctgc 17461 tcaattacct gcaccacgca cattgctaac taagggcaca ctagaaccag aatatttcaa 17521 ttcagtgtgt agacttatga aaactatagg tccagacatg ttcctcggaa cttgtcggcg 17581 ttgtcctgct gaaattgttg acactgtgag tgctttggtt tatgataata agcttaaagc 17641 acataaagac aaatcagctc aatgctttaa aatgttttat aagggtgtta tcacgcatga 17701 tgtttcatct gcaattaaca ggccacaaat aggcgtggta agagaattcc ttacacgtaa 17761 ccctgcttgg agaaaagctg tctttatttc accttataat tcacagaatg ctgtagcctc 17821 aaagattttg ggactaccaa ctcaaactgt tgattcatca cagggctcag aatatgacta 17881 tgtcatattc actcaaacca ctgaaacagc tcactcttgt aatgtaaaca gatttaatgt 17941 tgctattacc agagcaaaag taggcatact ttgcataatg tctgatagag acctttatga 18001 caagttgcaa tttacaagtc ttgaaattcc acgtaggaat gtggcaactt tacaagctga 18061 aaatgtaaca ggactcttta aagattgtag taaggtaatc actgggttac atcctacaca 18121 ggcacctaca cacctcagtg ttgacactaa attcaaaact gaaggtttat gtgttgacat 18181 acctggcata cctaaggaca tgacctatag aagactcatc tctatgatgg gttttaaaat 18241 gaattatcaa gttaatggtt accctaacat gtttatcacc cgcgaagaag ctataagaca 18301 tgtacgtgca tggattggct tcgatgtcga ggggtgtcat gctactagag aagctgttgg 18361 taccaattta cctttacagc taggtttttc tacaggtgtt aacctagttg ctgtacctac 18421 aggttatgtt gatacaccta ataatacaga tttttccaga gttagtgcta aaccaccgcc 18481 tggagatcaa tttaaacacc tcataccact tatgtacaaa ggacttcctt ggaatgtagt 18541 gcgtataaag attgtacaaa tgttaagtga cacacttaaa aatctctctg acagagtcgt 18601 atttgtctta tgggcacatg gctttgagtt gacatctatg aagtattttg tgaaaatagg 18661 acctgagcgc acctgttgtc tatgtgatag acgtgccaca tgcttttcca ctgcttcaga 18721 cacttatgcc tgttggcatc attctattgg atttgattac gtctataatc cgtttatgat 18781 tgatgttcaa caatggggtt ttacaggtaa cctacaaagc aaccatgatc tgtattgtca 18841 agtccatggt aatgcacatg tagctagttg tgatgcaatc atgactaggt gtctagctgt 18901 ccacgagtgc tttgttaagc gtgttgactg gactattgaa tatcctataa ttggtgatga 18961 actgaagatt aatgcggctt gtagaaaggt tcaacacatg gttgttaaag ctgcattatt 19021 agcagacaaa ttcccagttc ttcacgacat tggtaaccct aaagctatta agtgtgtacc 19081 tcaagctgat gtagaatgga agttctatga tgcacagcct tgtagtgaca aagcttataa 19141 aatagaagaa ttattctatt cttatgccac acattctgac aaattcacag atggtgtatg 19201 cctattttgg aattgcaatg tcgatagata tcctgctaat tccattgttt gtagatttga 19261 cactagagtg ctatctaacc ttaacttgcc tggttgtgat ggtggcagtt tgtatgtaaa 19321 taaacatgca ttccacacac cagcttttga taaaagtgct tttgttaatt taaaacaatt 19381 accatttttc tattactctg acagtccatg tgagtctcat ggaaaacaag tagtgtcaga 19441 tatagattat gtaccactaa agtctgctac gtgtataaca cgttgcaatt taggtggtgc 19501 tgtctgtaga catcatgcta atgagtacag attgtatctc gatgcttata acatgatgat 19561 ctcagctggc tttagcttgt gggtttacaa acaatttgat acttataacc tctggaacac 19621 ttttacaaga cttcagagtt tagaaaatgt ggcttttaat gttgtaaata agggacactt 19681 tgatggacaa cagggtgaag taccagtttc tatcattaat aacactgttt acacaaaagt 19741 tgatggtgtt gatgtagaat tgtttgaaaa taaaacaaca ttacctgtta atgtagcatt 19801 tgagctttgg gctaagcgca acattaaacc agtaccagag gtgaaaatac tcaataattt 19861 gggtgtggac attgctgcta atactgtgat ctgggactac aaaagagatg ctccagcaca 19921 tatatctact attggtgttt gttctatgac tgacatagcc aagaaaccaa ctgaaacgat 19981 ttgtgcacca ctcactgtct tttttgatgg tagagttgat ggtcaagtag acttatttag 20041 aaatgcccgt aatggtgttc ttattacaga aggtagtgtt aaaggtttac aaccatctgt 20101 aggtcccaaa caagctagtc ttaatggagt cacattaatt ggagaagccg taaaaacaca 20161 gttcaattat tataagaaag ttgatggtgt tgtccaacaa ttacctgaaa cttactttac 20221 tcagagtaga aatttacaag aatttaaacc caggagtcaa atggaaattg atttcttaga 20281 attagctatg gatgaattca ttgaacggta taaattagaa ggctatgcct tcgaacatat 20341 cgtttatgga gattttagtc atagtcagtt aggtggttta catctactga ttggactagc 20401 taaacgtttt aaggaatcac cttttgaatt agaagatttt attcctatgg acagtacagt 20461 taaaaactat ttcataacag atgcgcaaac aggttcatct aagtgtgtgt gttctgttat 20521 tgatttatta cttgatgatt ttgttgaaat aataaaatcc caagatttat ctgtagtttc 20581 taaggttgtc aaagtgacta ttgactatac agaaatttca tttatgcttt ggtgtaaaga 20641 tggccatgta gaaacatttt acccaaaatt acaatctagt caagcgtggc aaccgggtgt 20701 tgctatgcct aatctttaca aaatgcaaag aatgctatta gaaaagtgtg accttcaaaa 20761 ttatggtgat agtgcaacat tacctaaagg cataatgatg aatgtcgcaa aatatactca 20821 actgtgtcaa tatttaaaca cattaacatt agctgtaccc tataatatga gagttataca 20881 ttttggtgct ggttctgata aaggagttgc accaggtaca gctgttttaa gacagtggtt 20941 gcctacgggt acgctgcttg tcgattcaga tcttaatgac tttgtctctg atgcagattc 21001 aactttgatt ggtgattgtg caactgtaca tacagctaat aaatgggatc tcattattag 21061 tgatatgtac gaccctaaga ctaaaaatgt tacaaaagaa aatgactcta aagagggttt 21121 tttcacttac atttgtgggt ttatacaaca aaagctagct cttggaggtt ccgtggctat 21181 aaagataaca gaacattctt ggaatgctga tctttataag ctcatgggac acttcgcatg 21241 gtggacagcc tttgttacta atgtgaatgc gtcatcatct gaagcatttt taattggatg 21301 taattatctt ggcaaaccac gcgaacaaat agatggttat gtcatgcatg caaattacat 21361 attttggagg aatacaaatc caattcagtt gtcttcctat tctttatttg acatgagtaa 21421 atttcccctt aaattaaggg gtactgctgt tatgtcttta aaagaaggtc aaatcaatga 21481 tatgatttta tctcttctta gtaaaggtag acttataatt agagaaaaca acagagttgt 21541 tatttctagt gatgttcttg ttaacaacta aacgaacaat gtttgttttt cttgttttat 21601 tgccactagt ctctagtcag tgtgttaatc ttacaaccag aactcaatta ccccctgcat 21661 acactaattc tttcacacgt ggtgtttatt accctgacaa agttttcaga tcctcagttt 21721 tacattcaac tcaggacttg ttcttacctt tcttttccaa tgttacttgg ttccatgcta 21781 tacatgtctc tgggaccaat ggtactaaga ggtttgataa ccctgtccta ccatttaatg 21841 atggtgttta ttttgcttcc actgagaagt ctaacataat aagaggctgg atttttggta 21901 ctactttaga ttcgaagacc cagtccctac ttattgttaa taacgctact aatgttgtta 21961 ttaaagtctg tgaatttcaa ttttgtaatg atccattttt gggtgtttat taccacaaaa 22021 acaacaaaag ttggatggaa agtgagttca gagtttattc tagtgcgaat aattgcactt 22081 ttgaatatgt ctctcagcct tttcttatgg accttgaagg aaaacagggt aatttcaaaa 22141 atcttaggga atttgtgttt aagaatattg atggttattt taaaatatat tctaagcaca 22201 cgcctattaa tttagtgcgt gatctccctc agggtttttc ggctttagaa ccattggtag 22261 atttgccaat aggtattaac atcactaggt ttcaaacttt acttgcttta catagaagtt 22321 atttgactcc tggtgattct tcttcaggtt ggacagctgg tgctgcagct tattatgtgg 22381 gttatcttca acctaggact tttctattaa aatataatga aaatggaacc attacagatg 22441 ctgtagactg tgcacttgac cctctctcag aaacaaagtg tacgttgaaa tccttcactg 22501 tagaaaaagg aatctatcaa acttctaact ttagagtcca accaacagaa tctattgtta 22561 gatttcctaa tattacaaac ttgtgccctt ttggtgaagt ttttaacgcc accagatttg 22621 catctgttta tgcttggaac aggaagagaa tcagcaactg tgttgctgat tattctgtcc 22681 tatataattc cgcatcattt tccactttta agtgttatgg agtgtctcct actaaattaa 22741 atgatctctg ctttactaat gtctatgcag attcatttgt aattagaggt gatgaagtca 22801 gacaaatcgc tccagggcaa actggaaaga ttgctgatta taattataaa ttaccagatg 22861 attttacagg ctgcgttata gcttggaatt ctaacaatct tgattctaag gttggtggta 22921 attataatta cctgtataga ttgtttagga agtctaatct caaacctttt gagagagata 22981 tttcaactga aatctatcag gccggtagca caccttgtaa tggtgttgaa ggttttaatt 23041 gttactttcc tttacaatca tatggtttcc aacccactaa tggtgttggt taccaaccat 23101 acagagtagt agtactttct tttgaacttc tacatgcacc agcaactgtt tgtggaccta 23161 aaaagtctac taatttggtt aaaaacaaat gtgtcaattt caacttcaat ggtttaacag 23221 gcacaggtgt tcttactgag tctaacaaaa agtttctgcc tttccaacaa tttggcagag 23281 acattgctga cactactgat gctgtccgtg atccacagac acttgagatt cttgacatta 23341 caccatgttc ttttggtggt gtcagtgtta taacaccagg aacaaatact tctaaccagg 23401 ttgctgttct ttatcaggat gttaactgca cagaagtccc tgttgctatt catgcagatc 23461 aacttactcc tacttggcgt gtttattcta caggttctaa tgtttttcaa acacgtgcag 23521 gctgtttaat aggggctgaa catgtcaaca actcatatga gtgtgacata cccattggtg 23581 caggtatatg cgctagttat cagactcaga ctaattctcc tcggcgggca cgtagtgtag 23641 ctagtcaatc catcattgcc tacactatgt cacttggtgc agaaaattca gttgcttact 23701 ctaataactc tattgccata cccacaaatt ttactattag tgttaccaca gaaattctac 23761 cagtgtctat gaccaagaca tcagtagatt gtacaatgta catttgtggt gattcaactg 23821 aatgcagcaa tcttttgttg caatatggca gtttttgtac acaattaaac cgtgctttaa 23881 ctggaatagc tgttgaacaa gacaaaaaca cccaagaagt ttttgcacaa gtcaaacaaa 23941 tttacaaaac accaccaatt aaagattttg gtggttttaa tttttcacaa atattaccag 24001 atccatcaaa accaagcaag aggtcattta ttgaagatct acttttcaac aaagtgacac 24061 ttgcagatgc tggcttcatc aaacaatatg gtgattgcct tggtgatatt gctgctagag 24121 acctcatttg tgcacaaaag tttaacggcc ttactgtttt gccacctttg ctcacagatg 24181 aaatgattgc tcaatacact tctgcactgt tagcgggtac aatcacttct ggttggacct 24241 ttggtgcagg tgctgcatta caaataccat ttgctatgca aatggcttat aggtttaatg 24301 gtattggagt tacacagaat gttctctatg agaaccaaaa attgattgcc aaccaattta 24361 atagtgctat tggcaaaatt caagactcac tttcttccac agcaagtgca cttggaaaac 24421 ttcaagatgt ggtcaaccaa aatgcacaag ctttaaacac gcttgttaaa caacttagct 24481 ccaattttgg tgcaatttca agtgttttaa atgatatcct ttcacgtctt gacaaagttg 24541 aggctgaagt gcaaattgat aggttgatca caggcagact tcaaagtttg cagacatatg 24601 tgactcaaca attaattaga gctgcagaaa tcagagcttc tgctaatctt gctgctacta 24661 aaatgtcaga gtgtgtactt ggacaatcaa aaagagttga tttttgtgga aagggctatc 24721 atcttatgtc cttccctcag tcagcacctc atggtgtagt cttcttgcat gtgacttatg 24781 tccctgcaca agaaaagaac ttcacaactg ctcctgccat ttgtcatgat ggaaaagcac 24841 actttcctcg tgaaggtgtc tttgtttcaa atggcacaca ctggtttgta acacaaagga 24901 atttttatga accacaaatc attactacag acaacacatt tgtgtctggt aactgtgatg 24961 ttgtaatagg aattgtcaac aacacagttt atgatccttt gcaacctgaa ttagactcat 25021 tcaaggagga gttagataaa tattttaaga atcatacatc accagatgtt gatttaggtg 25081 acatctctgg cattaatgct tcagttgtaa acattcaaaa agaaattgac cgcctcaatg 25141 aggttgccaa gaatttaaat gaatctctca tcgatctcca agaacttgga aagtatgagc 25201 agtatataaa atggccatgg tacatttggc taggttttat agctggcttg attgccatag 25261 taatggtgac aattatgctt tgctgtatga ccagttgctg tagttgtctc aagggctgtt 25321 gttcttgtgg atcctgctgc aaatttgatg aagacgactc tgagccagtg ctcaaaggag 25381 tcaaattaca ttacacataa acgaacttat ggatttgttt atgagaatct tcacaattgg 25441 aactgtaact ttgaagcaag gtgaaatcaa ggatgctact ccttcagatt ttgttcgcgc 25501 tactgcaacg ataccgatac aagcctcact ccctttcgga tggcttattg ttggcgttgc 25561 acttcttgct gtttttcaga gcgcttccaa aatcataacc ctcaaaaaga gatggcaact 25621 agcactctcc aagggtgttc actttgtttg caacttgctg ttgttgtttg taacagttta 25681 ctcacacctt ttgctcgttg ctgctggcct tgaagcccct tttctctatc tttatgcttt 25741 agtctacttc ttgcagagta taaactttgt aagaataata atgaggcttt ggctttgctg 25801 gaaatgccgt tccaaaaacc cattacttta tgatgccaac tattttcttt gctggcatac 25861 taattgttac gactattgta taccttacaa tagtgtaact tcttcaattg tcattacttc 25921 aggtgatggc acaacaagtc ctatttctga acatgactac cagattggtg gttatactga 25981 aaaatgggaa tctggagtaa aagactgtgt tgtattacac agttacttca cttcagacta 26041 ttaccagctg tactcaactc aattgagtac agacactggt gttgaacatg ttaccttctt 26101 catctacaat aaaattgttg atgagcctga agaacatgtc caaattcaca caatcgacgg 26161 ttcatccgga gttgttaatc cagtaatgga accaatttat gatgaaccga cgacgactac 26221 tagcgtgcct ttgtaagcac aagctgatga gtacgaactt atgtactcat tcgtttcgga 26281 agagacaggt acgttaatag ttaatagcgt acttcttttt cttgctttcg tggtattctt 26341 gctagttaca ctagccatcc ttactgcgct tcgattgtgt gcgtactgct gcaatattgt 26401 taacgtgagt cttgtaaaac cttcttttta cgtttactct cgtgttaaaa atctgaattc 26461 ttctagagtt cctgatcttc tggtctaaac gaactaaata ttatattagt ttttctgttt 26521 ggaactttaa ttttagccat ggcagattcc aacggtacta ttaccgttga agagcttaaa 26581 aagctccttg aacaatggaa cctagtaata ggtttcctat tccttacatg gatttgtctt 26641 ctacaatttg cctatgccaa caggaatagg tttttgtata taattaagtt aattttcctc 26701 tggctgttat ggccagtaac tttagcttgt tttgtgcttg ctgctgttta cagaataaat 26761 tggatcaccg gtggaattgc tatcgcaatg gcttgtcttg taggcttgat gtggctcagc 26821 tacttcattg cttctttcag actgtttgcg cgtacgcgtt ccatgtggtc attcaatcca 26881 gaaactaaca ttcttctcaa cgtgccactc catggcacta ttctgaccag accgcttcta 26941 gaaagtgaac tcgtaatcgg agctgtgatc cttcgtggac atcttcgtat tgctggacac 27001 catctaggac gctgtgacat caaggacctg cctaaagaaa tcactgttgc tacatcacga 27061 acgctttctt attacaaatt gggagcttcg cagcgtgtag caggtgactc aggttttgct 27121 gcatacagtc gctacaggat tggcaactat aaattaaaca cagaccattc cagtagcagt 27181 gacaatattg ctttgcttgt acagtaagtg acaacagatg tttcatctcg ttgactttca 27241 ggttactata gcagagatat tactaattat tatgaggact tttaaagttt ccatttggaa 27301 tcttgattac atcataaacc tcataattaa aaatttatct aagtcactaa ctgagaataa 27361 atattctcaa ttagatgaag agcaaccaat ggagattgat taaacgaaca tgaaaattat 27421 tcttttcttg gcactgataa cactcgctac ttgtgagctt tatcactacc aagagtgtgt 27481 tagaggtaca acagtacttt taaaagaacc ttgctcttct ggaacatacg agggcaattc 27541 accatttcat cctctagctg ataacaaatt tgcactgact tgctttagca ctcaatttgc 27601 ttttgcttgt cctgacggcg taaaacacgt ctatcagtta cgtgccagat cagtttcacc 27661 taaactgttc atcagacaag aggaagttca agaactttac tctccaattt ttcttattgt 27721 tgcggcaata gtgtttataa cactttgctt cacactcaaa agaaagacag aatgattgaa 27781 ctttcattaa ttgacttcta tttgtgcttt ttagcctttc tgctattcct tgttttaatt 27841 atgcttatta tcttttggtt ctcacttgaa ctgcaagatc ataatgaaac ttgtcacgcc 27901 taaacgaaca tgaaatttct tgttttctta ggaatcatca caactgtagc tgcatttcac 27961 caagaatgta gtttacagtc atgtactcaa catcaaccat atgtagttga tgacccgtgt 28021 cctattcact tctattctaa atggtatatt agagtaggag ctagaaaatc agcaccttta 28081 attgaattgt gcgtggatga ggctggttct aaatcaccca ttcagtacat cgatatcggt 28141 aattatacag tttcctgttt accttttaca attaattgcc aggaacctaa attgggtagt 28201 cttgtagtgc gttgttcgtt ctatgaagac tttttagagt atcatgacgt tcgtgttgtt 28261 ttagatttca tctaaacgaa caaactaaaa tgtctgataa tggaccccaa aatcagcgaa 28321 atgcaccccg cattacgttt ggtggaccct cagattcaac tggcagtaac cagaatggag 28381 aacgcagtgg ggcgcgatca aaacaacgtc ggccccaagg tttacccaat aatactgcgt 28441 cttggttcac cgctctcact caacatggca aggaagacct taaattccct cgaggacaag 28501 gcgttccaat taacaccaat agcagtccag atgaccaaat tggctactac cgaagagcta 28561 ccagacgaat tcgtggtggt gacggtaaaa tgaaagatct cagtccaaga tggtatttct 28621 actacctagg aactgggcca gaagctggac ttccctatgg tgctaacaaa gacggcatca 28681 tatgggttgc aactgaggga gccttgaata caccaaaaga tcacattggc acccgcaatc 28741 ctgctaacaa tgctgcaatc gtgctacaac ttcctcaagg aacaacattg ccaaaaggct 28801 tctacgcaga agggagcaga ggcggcagtc aagcctcttc tcgttcctca tcacgtagtc 28861 gcaacagttc aagaaattca actccaggca gcagtagggg aacttctcct gctagaatgg 28921 ctggcaatgg cggtgatgct gctcttgctt tgctgctgct tgacagattg aaccagcttg 28981 agagcaaaat gtctggtaaa ggccaacaac aacaaggcca aactgtcact aagaaatctg 29041 ctgctgaggc ttctaagaag cctcggcaaa aacgtactgc cactaaagca tacaatgtaa 29101 cacaagcttt cggcagacgt ggtccagaac aaacccaagg aaattttggg gaccaggaac 29161 taatcagaca aggaactgat tacaaacatt ggccgcaaat tgcacaattt gcccccagcg 29221 cttcagcgtt cttcggaatg tcgcgcattg gcatggaagt cacaccttcg ggaacgtggt 29281 tgacctacac agctgccatc aaattggatg acaaagatcc aaatttcaaa gatcaagtca 29341 ttttgctgaa taagcatatt gacgcataca aaacattccc accaacagag cctaaaaagg 29401 acaaaaagaa gaaggctgat gaaactcaag ccttaccgca gagacagaag aaacagcaaa 29461 ctgtgactct tcttcctgct gcagatttgg atgatttctc caaacaattg caacaatcca 29521 tgagcagtgc tgactcaact caggcctaaa ctcatgcaga ccacacaagg cagatgggct 29581 atataaacgt tttcgctttt ccgtttacga tatatagtct actcttgtgc agaatgaatt 29641 ctcgtaacta catagcacaa gtagatgtag ttaactttaa tctcacatag caatctttaa 29701 tcagtgtgta acattaggga ggacttgaaa gagccaccac attttcaccg aggccacgcg 29761 gagtacgatc gagtgtacag tgaacaatgc tagggagagc tgcctatatg gaagagccct 29821 aatgtgtaaa attaatttta gtagtgctat ccccatgtga ttttaatagc ttctt https://www.ncbi.nlm.nih.gov/nuccore/1796487982
-
WHO Acknowledges Limited Human To Human Transmission of 2019-nCoV
niman replied to niman's topic in China (COVID)
Questions and answers on pneumonia outbreak of new coronavirus infection (January 14, 2020) Issuing authority: Wuhan City health committee | Published: 2020-01-15 00:10:06 | Hits: 2133 | Font Size: Da Zhong Small 1. Recently, a tourist from Wuhan was diagnosed with a new coronavirus-infected pneumonia patient in Thailand. Please introduce the situation. On January 13, 2020, Thailand reported a case of pneumonia with a new coronavirus infection from Wuhan. The city attaches great importance to timely investigation. The patient is a citizen of our city and is now receiving treatment in Thailand with a stable condition. At the same time, the health department conducted medical observations on all close contacts of the patient found, and there is no abnormal performance at present. 2. At present, in order to detect pneumonia cases of new coronavirus infection as early as possible, what measures have been taken in our city? After the outbreak, the city quickly carried out screening of relevant cases in all medical institutions in the city. Up to now, the expert group has integrated the clinical manifestations, epidemiological history, and laboratory test results of patients to determine new cases of pneumonia caused by coronavirus. 41 example. Recently, our city has further strengthened case monitoring and search. On the one hand, we continue to do a good job of monitoring for pneumonia of unknown cause, and on the other hand, we carry out case searches at various medical institutions at all levels in our city in order to detect cases early. 3. As of now, has there been any case of human-to-human transmission? Existing survey results show that clear human-to-human evidence has not been found, and the possibility of limited human-to-human transmission cannot be ruled out, but the risk of continued human-to-human transmission is low. Further research is currently underway combining clinical and epidemiological data. 4. Has a family clustering case been found? Among the 41 cases currently diagnosed , one was found to be clustered in the family. The husband and wife developed the disease first, and the husband first developed the disease. He was an employee of the South China Seafood Wholesale Market. His wife denied a history of South China Seafood Wholesale Market exposure. 5. What are close contacts? Why medical observation of close contacts for 14 days? If close contacts develop symptoms during the observation period, how can they be diagnosed and diagnosed? At present, the close contacts defined in this epidemic are those who live with patients, work and study in the same room, live in the same room, and who have not taken effective protective measures during the diagnosis and treatment of cases. Laboratory testing personnel, other patients or accompanying staff in the ward, other contact situations determined by disease control professionals in the same transportation with the patient and close contact with the person. With reference to the incubation period of diseases caused by other coronaviruses, information about this new coronavirus case, and current prevention and control practices, the medical observation period for close contacts is set to 14 days, and home medical observations are made for close contacts. During the observation period, once the close contacts are found to have abnormal clinical manifestations such as fever and cough, the close contacts will be sent to the designated medical institution for investigation, diagnosis and treatment in a timely manner. 6. What are the characteristics of the epidemic that have been found so far? What is the development trend of the epidemic? Of the 41 cases diagnosed, most were male, and the number of middle-aged and elderly people was higher. In the early stage of the case, fever and cough are the main symptoms, which can be manifested as persistent mild disease in the early stage. Older patients with underlying disease are more likely to progress to severe disease. Preliminary results of existing etiology studies and epidemiological investigations show that most of the cases are related to the South China Seafood Wholesale Market exposure, a few cases deny a history of South China Seafood Wholesale Market exposure, and some cases have been exposed to similar cases. No community transmission has been identified. 7. After closing the South China Seafood Wholesale Market, are there any findings in the market? What measures have other markets taken? After the South China Seafood Wholesale Market was closed, the city strengthened its disposal of market environmental hygiene, carried out disinfection and sanitary disposal of the market, and carried out garbage cleaning and disinfection. In order to strengthen the traceability work, environmental specimens are collected and tested in the market. At present, the test results found that some samples were positive for new coronavirus. At the same time, preliminary investigations have been conducted in other markets, and no clues related to the source of the infection have been found. http://wjw.wuhan.gov.cn/front/web/showDetail/2020011509040 -
WHO Acknowledges Limited Human To Human Transmission of 2019-nCoV
niman replied to niman's topic in China (COVID)
http://webtv.un.org/watch/geneva-press-briefing-unctad-who-wfp-ohchr-iom-unhcr-ilo/6122495888001/ At 18:40 mark "So far with this coronavirus we have limited human to human transmission" later says epi studies ongoing regarding H2H -
2019-nCoV 61F Patient Visited Other Markets In Wuhan
niman replied to niman's topic in Thailand (2019-nCoV)
Video of today's WHO update. At 4 minute mark they acknowledge that 61F traveler did NOT visit Seafood Market, but had been to other wet markets in Wuhan prior to trip to Bangkok http://webtv.un.org/watch/geneva-press-briefing-unctad-who-wfp-ohchr-iom-unhcr-ilo/6122495888001/ -
WHO Acknowledges Limited Human To Human Transmission of 2019-nCoV
niman replied to niman's topic in China (COVID)
14 January 2020 Alessandra Vellucci, Director of the United Nations Information Service in Geneva, chaired the briefing, which was attended by the spokespersons for the United Nations Conference on Trade and Development, the World Health Organization, the World Food Programme, the Office of the High Commissioner for Human Rights, the International Organization for Migration, the United Nations High Commissioner for Refugees and the International Labour Organization. Novel coronvirus in China Tarik Jašarevic for the World Health Organization (WHO), said that on 31 December 2019, the Government of China had reported a cluster of cases of pneumonia of unknown cause in Wuhan, Hubei Province. On 9 January Chinese authorities had made a preliminary determination of a new coronavirus, identified in a hospitalized person with pneumonia in Wuhan. Two days later, Chinese authorities had issued additional information, updating case numbers to 41, reporting one death. They had also shared the complete genomic sequence with WHO and with the public. On 13 January, the health authorities of Thailand had announced the identification of the novel coronvirus in a person traveling from Wuhan. WHO was still in the earliest stages of understanding this new virus, where it came from, and how it affected people. Preliminary investigations conducted by national authorities had found no clear evidence of human to human transmission and there were no infections reported among health care workers. However, the mode(s) of transmission had not yet been determined and human to human transmission was always a concern when patients had respiratory symptoms, and this required further investigation. The genetic sequencing, shared by China on 11 January, enabled more countries to rapidly diagnose patients. This had helped Thailand identify the infected person. So far, 41 suspected cases had tested positive in China for the new coronavirus. Of the 41 cases, seven have been discharged, six were severe, and one person has died. The other patients were reported in stable condition. The reported dates of symptom onset ranged between 8 December 2019-2 January 2020. No new cases had been reported by China since 3 January 2020. Common symptoms had included fever, breathing difficulties and pneumonia. 763 close contacts, including health workers, had been tracked until now and were being monitored for signs of illness; no related cases had been found. The follow-up of close contacts was still in progress. Investigations had found that some of the cases were workers, handlers or frequent visitors at a seafood market in Wuhan where live animals were sold, the Huanan seafood market. WHO had been in regular and direct contact with Chinese and Thai authorities since the reporting of these cases. Both China and Thailand had shared information with WHO under the IHR. WHO was also informing other countries about the situation and providing support as requested. WHO was working with its networks of researchers and other experts to coordinate global work on surveillance, epidemiology, modelling, diagnostics, clinical care and treatment, and other ways to identify, manage the disease and limit onward transmission. WHO was working closely with countries to help them prepare for the rapid detection and response to cases or clusters. Even before an outbreak stroke, WHO offered technical advice and capacity strengthening as needed, including laboratory support. There were no immediate plans to call an Emergency Committee. However, the committee could be convened on short notice if needed. Maria D. Van Kerkhove, Head ai of Emerging Diseases and Zoonoses Unit at the World Health Organization (WHO), said the disease will range from mild symptoms to very severe disease and death. The global community had a lot of experience with past coronaviruses. Based on experience, these viruses had the possibility to be transmitted from animals to humans. There was a possibility that transmission could be amplified, including in health care facilities. There was also a possibility of superspreading events – that was on WHO’s radar. It was important to identify the pathogen and the source of the outbreak; there were several ongoing investigations in that regard. It was important to determine which diseases the coronvirus caused, and if there had been human to human transmission. Information was needed to limit exposure and better understand the extent of infection. Responding to questions from journalists, Mr. Jašarevic said that, for now, no travel or trade restrictions had been imposed in relation to this virus. Ms. Van Kerkhove added that WHO was developing diagnostic tests and guidelines to ensure a quick identification of infections. Currently, treatment of infected individuals was based on their specific symptoms. https://www.unog.ch/unog/website/news_media.nsf/(httpNewsByYear_en)/F218C2070663E4F1C12584EB0050DE5E?OpenDocument -
2019-nCoV 61F Patient Visited Other Markets In Wuhan
niman replied to niman's topic in Thailand (2019-nCoV)
Hong Kong / Health & Environment Wuhan pneumonia: Chinese tourist in Thai case did not visit outbreak-linked market, while scientists say virus not likely to prove as deadly as Sars Woman, 61, could have caught the virus in Wuhan at other markets, as her infection has no relation to Huanan Seafood Wholesale Market Chinese researchers released the genome sequence of the coronavirus over the weekend and one researcher said it was ‘not particularly close to Sars’ Elizabeth Cheung,Jitsiree Thongnoi,Stephen Chen in Beijing,Zhuang Pinghui in Beijing Published: 5:07pm, 14 Jan, 2020 The Huanan Wholesale Seafood Market has been closed since January 1. Photo: AFP The new virus behind recent pneumonia cases in Wuhan is unlikely to cause a widespread, deadly epidemic like Sars, scientists say, as revelations that a Chinese tourist in Thailand had not visited the market linked to the outbreak raised fears of a potential spread of the disease. The woman, 61, who was confirmed by Thai authorities to have the new virus, had not visited the now-closed mainland seafood market associated with the outbreak, the Post learned on Tuesday. The discovery raised fears that the woman, the first confirmed case outside China, could have caught the virus in Wuhan at other markets, which she was understood to have visited. That came as Reuters quoted the World Health Organisation as saying there had been “limited” human-to-human transmission of the new coronavirus, but WHO spokesman Tarik Jasarevic told the Post in an email reply that “there has been no evidence” of such an occurrence. Hong Kong’s Chief Executive Carrie Lam Cheng Yuet-ngor said an expert meeting would be held on Wednesday to discuss the latest development of the disease, upon the return of a team of local health officials who visited Wuhan to gain first-hand knowledge. The virus has struck at least 41 people in Wuhan. Photo: Jun Mai When asked why details of the two-day visit were not disclosed to the public, Lam said: “The trip, organised by the county's National Health Commission, invited not only delegates from Hong Kong, but also from Macau and Taiwan to understand how the mainland authorities have been handling the disease. It has not been kept secret.” The tourist, who travelled to Bangkok from the city in Hubei province, was found to have a fever on arrival at Suvarnabhumi Airport on January 8 and was hospitalised that day. She was confirmed on Sunday to have been infected with the new coronavirus strain, which has struck at least 41 people in Wuhan and killed one. Don’t miss critical news from Hong Kong & the world Follow us on FACEBOOKTWITTER Dr Sopon Eamsiritavorn, from the Thai Ministry of Public Health’s Department of Disease Control, told the Post it appeared the woman’s infection was not related to the Huanan Seafood Wholesale Market, which Chinese authorities had linked to the Wuhan outbreak and had been closed since January 1. “It seems there’s no relation with the market,” he said, when asked whether the patient had visited the outbreak site. A source familiar with the details of the case said the woman did not visit the market. “But she did visit other markets before going to Thailand,” the source said. Detailed investigations into the case were in progress. With genetic details, Hong Kong to rush new test for Wuhan virus 13 Jan 2020 Hong Kong’s Centre for Health Protection said on Tuesday that it had been closely monitoring the case in Thailand. Professor David Hui Shu-cheong, a respiratory medicine expert from Chinese University, had previously said that if the woman had not been to the seafood market, it would suggest that the virus had spread to other parts of Wuhan. Details on investigations in Thailand could be found by following reports from officials there, Jasarevic said. Between December 31 and Tuesday, Hong Kong had reported 71 suspected cases, with 60 of them cleared and discharged. Meanwhile, scientists who have studied the genome of the virus behind the recent outbreak believe it is unlikely to cause a widespread, deadly epidemic like Sars. The unnamed virus has been identified as a new strain of coronavirus, the same family of viruses as severe acute respiratory syndrome. Chinese scientists released the virus’s genome sequence to the public on Saturday, and researchers who analysed the sequence said it was a distant relative of Sars and therefore unlikely to be as deadly. “The description given by the Chinese scientists is accurate. This virus is not SARS-CoV and not particularly close by many standards. Based on previous research … the virus is likely attenuated in terms of disease,” said Vineet Menachery, an assistant professor with the University of Texas Medical Branch’s department of microbiology and immunology in Galveston. Menachery analysed the genome sequence and found it had only about 73 per cent similarity to Sars. “In certain patients, older people or people with comorbidities, the virus may cause more damage, but is not nearly problematic as the epidemic SARS-CoV strain,” he added. The market at the centre of the outbreak has now been closed. Photo: AFP Ralph Baric, a coronavirus researcher at the University of North Carolina, Chapel Hill, came up with a similar conclusion after his team tried to replicate the virus in their laboratory based on the genetic code provided by Chinese scientists. Of the four known Sars-related bat viruses capable of infecting humans, this one was the most distant from Sars itself, Baric told Science. Baric also praised the speed of the response to the virus. “One of the things that’s sad is that the public doesn’t realise how incredibly competent the public health and the basic science community are at going from a newly discovered virus to a tremendous amount of capacity to trace and try to control its spread,” he told the journal. Xu Jianguo, head of an evaluation committee advising the Chinese government on the emerging virus, also told Science in an interview published on Friday that no new patients had appeared since January 5. “It’s good news. People fear something like Sars in 2003, but this is a different case. The outbreak is limited,” he said. Mainland Chinese authorities to allow two Taiwan specialists to visit Wuhan 12 Jan 2020 There had been worries about the transparency of the Chinese government's handling of the outbreak but now that concern had largely been dismissed, according to the Science report. Dr Hu Ming, deputy director of the department of epidemiology and health statistics at Central South University in Changsha, said she had been following the situation in Wuhan closely and had not found any signs of a cover-up after the health authorities first announced the outbreak on December 31. “There was lots of work to do. Sequencing, for instance, would take time. The data must be verified carefully before release. I believe they are following strict, professional procedures,” she said. “We have learned a painful lesson from Sars.” Scientists say the virus is a distant relation of Sars. Photo: AFP Feng Zijian, deputy director of the Chinese Centre for Disease Control and Prevention, told China Central Television on Tuesday that the genome sequence of the coronavirus had showed it was “neither Sars nor Mers” (Middle East respiratory syndrome) and the difference in their genome sequences was “very big”. Sars infected more than 8,000 people, killing over 700 globally after originating in China in 2003. In a Sunday statement, the WHO said the outbreak was probably associated with one seafood market in Wuhan, which had since been closed. It also said it was “reassured of the quality of the ongoing investigations and the response measures implemented in Wuhan, and the commitment to share information regularly”. The new virus was isolated, analysed and its genetic information released to the world 10 days after the confirmed outbreak. In 2003, it took more than three months to do the same with Sars. https://www.scmp.com/news/hong-kong/health-environment/article/3046030/wuhan-pneumonia-chinese-tourist-thai-case-did-not -
2019-nCoV 61F Patient Visited Other Markets In Wuhan
niman replied to niman's topic in Thailand (2019-nCoV)
The woman, 61, who was confirmed by Thai authorities to have the new virus, had not visited the now-closed mainland seafood market associated with the outbreak, the Post learned on Tuesday. The discovery raised fears that the woman, the first confirmed case outside China, could have caught the virus in Wuhan at other markets, which she was understood to have visited. https://www.scmp.com/news/hong-kong/health-environment/article/3046030/wuhan-pneumonia-chinese-tourist-thai-case-did-not -
WHO Acknowledges Limited Human To Human Transmission of 2019-nCoV
niman replied to niman's topic in China (COVID)
Wuhan virus spreading between people: WHO 2020-01-14 HKT 19:27 There has been “limited” human-to-human transmission of a new coronavirus that has struck the mainland city of Wuhan, mainly small clusters in families, but there is potential for wider spreading, the World Health Organisation (WHO) said on Tuesday. A Chinese woman has been quarantined in Thailand with a mystery strain, authorities said on Monday, the first time it has been detected outside China. In all, 41 cases of the virus – which is similar to Sars which killed 299 in Hong Kong in 2003 – have been reported in Wuhan, mainly through exposure at a seafood market. One person there has died. Dr. Maria Van Kerkhove, acting head of the WHO’s emerging diseases unit, told a Geneva news briefing that the agency had given guidance to hospitals worldwide about infection control in case of spread, including by a “super-spreading” event in a health care setting. “This is something on our radar, it is possible, we need to prepare ourselves,” she said. Hong Kong health officials have put dozens of people in isolation in hospital since New Year's Eve over fears they have caught the virus following trips to Wuhan, with three new suspected cases just on Tuesday. But the SAR authorities haven't announced any confirmed cases and although Taiwan, Singapore and South Korea have all reported suspected cases, no province on the mainland, other than Hubei, has reported any patients feared to have the virus. (Refinitiv, RTHK) https://news.rthk.hk/rthk/en/component/k2/1502767-20200114.htm -
WHO Acknowledges Limited Human To Human Transmission of 2019-nCoV
niman replied to niman's topic in China (COVID)
WHO says new China virus could spread, it's warning all hospitals GENEVA (Reuters) - There has been “limited” human-to-human transmission of a new coronavirus that has struck in China, mainly small clusters in families, but there is potential for wider spread, the World Health Organization (WHO) said on Tuesday. A Chinese woman has been quarantined in Thailand with a mystery strain, authorities said on Monday, the first time it has been detected outside China. In all, 41 cases of pneumonia - a symptom of the disease - have been reported in the central Chinese city of Wuhan, mainly through exposure at a seafood market. Dr. Maria Van Kerkhove, acting head of WHO’s emerging diseases unit, told a Geneva news briefing that the agency had given guidance to hospitals worldwide about infection control in case of spread, including by a “super-spreading” event in a health care setting. “This is something on our radar, it is possible, we need to prepare ourselves,” she said. Reporting by Stephanie Nebehay; editing by John Stonestreet Our Standards:The Thomson Reuters Trust Principles. https://www.reuters.com/article/us-china-health-pneumonia-who-idUSKBN1ZD16J -
2019-nCoV 61F Patient Visited Other Markets In Wuhan
niman replied to niman's topic in Thailand (2019-nCoV)
The cluster of the novel coronavirus was initially reported on Dec. 31. Since then, most cases were found to involve workers at or frequent visitors to Wuhan's Huanan Seafood Wholesale Market, which has been temporarily closed while environmental disinfection is carried out. http://www.chinadaily.com.cn/a/202001/14/WS5e1d554fa310128217270cc6.html -
2019-nCoV 61F Patient Visited Other Markets In Wuhan
niman replied to niman's topic in Thailand (2019-nCoV)
Health minister visits Chinese tourist with coronavirus Recovering patient anxious to go home but caution essential, says chief of Infectious Diseases Institute where three others under observation 7 mins ago 1 minute read FacebookTwitterPinterestPrint Photo Credit: Public Health Ministry A 61-year-old Chinese woman who has become the first person to receive treatment in Thailand for the coronavirus newly identified in Wuhan in her homeland had a visit this week from Deputy Prime Minister Anutin Charnvirakul. Anutin, who is also Minister of Public Health, on Tuesday paid the morale-boosting visit at Nonthaburi’s Bamrasnaradura Infectious Diseases Institute (BIDI), where three other tourists from Wuhan are being monitored for signs of the disease. The woman, whose name has not been released, is said to be recovering and was previously due to be moved out of the institute on Monday (January 13). But Department of Disease Control (DDC) director-general Dr Suwannachai Wattanayingcharoenchai said she was asked to remain in quarantine after traces of coronavirus DNA were found in lab samples. Anutin said she would be going home “soon”, once protocols for preventing transnational epidemics had been met. At least two labs – one at the Department of Medical Sciences and the other at Chulalongkorn University’s Faculty of Medicine – are testing the samples further. Anutin said the woman eats little and is under stress, having been alone in quarantine since last Wednesday. He told her he understood her frustration but urged her to try and remain calm. Photo Credit: Public Health Ministry The minister presented a gift basket to her relatives, who in turn thanked officials for taking care of them. The patient, speaking through an intercom, said she wanted to go home and was worried about the young relatives travelling with her. Dr Suwannachai explained that health authorities have to proceed cautiously since so little is known about the coronavirus or its ability to spread. The same precautionary measures are being applied as with Middle East respiratory syndrome (MERS), first identified in 2012. He said the woman would likely be moved from the Airborne Infection Isolation Room later Tuesday. BIDI director Dr Apichat Wachirapan said three other Chinese travellers were also in the isolation room – a six-year-old admitted on Sunday and a five-year-old and a 75-year-old admitted on Monday. Although they appear to have the common flu, he said, samples from all three are being lab-tested as a precaution. Anyone returning to Thailand from the Wuhan area in central Hubei province and experiencing fever, sore throat, coughing, a runny nose or difficulty breathing is urged to seek medical attention or call the DDC hotline, 1422. https://www.thailandtoday.co/health-minister-visits-chinese-tourist-with-coronavirus/ -
Accession ID: EPI_ISL_402125 Type: betacoronavirus Passage details/history: unknown Sample information Collection date: 2019-12 Location: China Host: Homo sapiens
-
2019-nCoV 61F Patient Visited Other Markets In Wuhan
niman replied to niman's topic in Thailand (2019-nCoV)
'Diary' encourages patients with coronary infections. Revealing more Chinese patients "Diary" encourage Patients with a new strain of corona. Explanation of the cause of not leaving home because still detecting the genetic material While S. Bamrat Accepting 3 additional Chinese patients. Preliminary examination has not been found. Tuesday 14 January 2020 at 14.03 hrs. On 14 January at Bamrasnaradura Institute, Mr. Anutin Charnverakul, Deputy Prime Minister and The Minister of Public Health visited and inspected Chinese patients infected with the new strain of corona virus. Incoming treatment At the Bharat Institute on January 8, ago At the same time, there was also talk and encouragement with relatives of this Chinese patient. Including encouraging patients and asking to be patient. The relatives thanked the Thai government for providing good care and providing accommodation before they were admitted to the Bamras Institute. There is still concern because patients have chronic illnesses, such as high blood pressure and carry drugs. Almost come to an end, but at the moment, the Bamras Institute After having examined and provided blood pressure medication, the patients were relieved. After that, the relatives had conversations through the intercom with the patients in the separation room, encouraging the patients to heal. Don't worry. Since the Thai authorities now take good care However, the patients responded that they wanted to go home and were worried about their accompanying children, as they were young and therefore worried that they could not eat much. May cause illness. Mr Anutin said that from the visit, this Chinese patient has been reported to have no fever. Depending on eating a little and having a little stress because having to live in a separation room alone, not going anywhere However, according to inquiries, this patient did not go to the market that the Chinese authorities ordered to close. But going to other markets Initially, the patient has no fever and is considered to be healed. But still have to wait for the lab test results again For the Chinese patients admitted at Bamras Institute, now 3 more are just normal flu. But stressed because he was in the separation room Some people would like to eat fried chicken. We try to provide to help him reduce stress. At the moment, it is under further examination. If there is no virus that we are monitoring, we will go back home. If wanting to continue traveling without any problems Reiterate the public, do not be alarmed During this period, if you can't avoid going to Wuhan, please don't go. In Thailand, it may be necessary to avoid areas with a lot of people. Anyone who sneezing, having a runny nose can take care of themselves as normal. And in the nature of humans, when infected, the body will build immunity to protect the body, there will be drugs or vaccines to prevent this disease or may have to wait. The important thing is if you have a fever There is a risk, please come and see a doctor as soon as possible to treat everything, everything that Thailand does. Is to follow the procedures of the World Health Organization. Please be comfortable. Dr. Suwanchai Wattanayingcharoenchai, MD. Director-General of the Department of Disease Control Said that Chinese patients currently receiving treatment at Bamrasnaradura Institute have improved their symptoms without fever, but due to the presence of the coronal virus genetic material in the specimen, it is still unable to release home. Yes, because we currently have restrictions on the data of the new strain of corona virus, so we cannot release the risk of infecting people in public areas. We must take the preventive measures of the highest disease equal to the MERS infection. However, it is expected that patients may be able to leave the separation room today. Dr. Suwannachai continues, “The genetic material, if compared, is the same as humans after life. Can still detect DNA Therefore, even if the corona infection is the same Even if the infection is dead, we can still detect the genetic material. However, at this time we have collected samples. Infection because to find important information relevant ' Dr. Aphichat Wachiraphan, Director of Bamras Institute Said that at this time the institute Also received 3 Chinese people to be taken care of in the separation room to monitor the coronary infection. Because found to have fever The first is a 6-year-old child who came to look after at the Bamras Institute on January 12, while the other 2 are 5-year-old children and an elderly aged 75 years come to take care on 13 Jan ago, specimens have been collected for laboratory tests at the Department of Medical Sciences and Emerging Disease Health Science Center. Faculty of Medicine Chulalongkorn University Expected to know the test results soon.... อ่านต่อที่ : https://www.dailynews.co.th/politics/751794 -
Tourist from Wuhan (61F) did not visit Seafood Market with 2019-nCoV, but visited other wet markets prior to trip to Bangkok: according to inquiries, this patient did not go to the market that the Chinese authorities ordered to close. But going to other markets... อ่านต่อที่ : https://www.dailynews.co.th/politics/751794
-
Novel coronavirus complete genome from the Wuhan outbreak now available in GenBank The complete annotated genome sequence of the novel coronavirus associated with the outbreak of pneumonia in Wuhan, China is now available from GenBank for free and easy access by the global biomedical community. Figure 1 shows the relationship of the Wuhan virus to selected coronaviruses. Figure 1. Phylogenetic tree showing the relationship of Wuhan-Hu-1 (circled in red) to selected coronaviruses. Nucleotide alignment was done with MUSCLE 3.8. The phylogenetic tree was estimated with MrBayes 3.2.6 with parameters for GTR+g+i. The scale bar indicates estimated substitutions per site, and all branch support values are 99.3% or higher. According to the CDC, as of January 11, Chinese health authorities say they’ve identified more than 40 human infections as part of this outbreak that was first reported on December 31. The World Health Organization announced the preliminary identification of the novel coronavirus on January 9. The GenBank record of Wuhan-Hu-1 includes sequence data, annotation and metadata from this virus isolated approximately two weeks ago from a patient believed to have contracted the disease in a Hubei province seafood market. Rapid access to sequence data from public databases such as GenBank plays a vital role in helping countries develop specific diagnostic kits for disease outbreaks like this one. https://ncbiinsights.ncbi.nlm.nih.gov/2020/01/13/novel-coronavirus/
-
13 January 2020 Health It is “essential” for China to continue investigating the source of a previously unknown strain of coronavirus, the World Health Organization (WHO) declared on Monday, following confirmation that an infected patient is being treated in Thailand. 70 people are talking about this In its statement, WHO identified the patient as a traveller from Wuhan, in China, who was hospitalized in Thailand on January 8. According to Thai authorities, the patient is recovering from the illness. The novel coronavirus is believed to have originated in Wuhan, infecting dozens of people in China and, on Saturday, Chinese media reported the first known death from the virus. Coronaviruses rely on animal to human transmission, and the health commission in Wuhan has reportedly declared that there is no evidence of any spread between humans. However, given recent developments, WHO chief, Tedros Adhanom Ghebreyesus, is planning to consult with the members of the agency’s Emergency Committee, and could call for a meeting of the Committee at short notice. In its Monday statement, WHO noted that it has been expecting cases to be reported in countries other than China, underscoring the importance of monitoring and preparedness in other countries. The work of WHO and the Chinese authorities in containing the new coronavirus will be made more complicated by the Spring Festival, or Chinese New Year, which begins on January 25, and sees hundreds of millions criss-crossing the country. WHO has issued guidance on how to detect and treat persons ill with the new virus: standard recommendations for halting the spread of coronaviruses include regular hand washing; covering your mouth and nose when coughing and sneezing; thoroughly cooking meat and eggs; and avoiding close contact with anyone showing symptoms of respiratory illness, such as coughing and sneezing. What is a coronavirus? Coronaviruses are described by WHO as “a large family of viruses that cause illness ranging from the common cold to more severe diseases”. Probably the best known is Severe Acute Respiratory Syndrome, commonly known as SARS, which broke out in Asia in 2003, and spread to countries in North America, South America and Europe, before being successfully contained later that year. Coronaviruses are transmitted between animals and people, and there are several known coronaviruses currently circulating in animals, that have not yet infected humans. Common signs of infection include respiratory symptoms, fever, cough, shortness of breath and breathing difficulties. In more severe cases, infection can cause pneumonia, severe acute respiratory syndrome, kidney failure and even death. https://news.un.org/en/story/2020/01/1055212?123
-
Thailand Confirms Traveler from China Hospitalized With New Form of Coronavirus, According to U.N. Officials A woman walks in front of the closed Huanan wholesale seafood market, where health authorities say a man who died from a respiratory illness had purchased goods from, in the city of Wuhan, Hubei province, on January 12, 2020. Noel Celis—AFP/Getty Images BY ASSOCIATED PRESS 11:32 AM EST (BANGKOK) — A Chinese visitor to Thailand has been confirmed to be infected with a new strain of coronavirus that has been linked to a pneumonia outbreak in central China, health officials said Monday. The U.N.’s World Health Organization said Thai officials have reported that a traveler from the Chinese city of Wuhan has been hospitalized in Thailand with the virus. The outbreak of the virus has been traced to Wuhan, where it affected several dozen people who had been to a major meat and seafood market. Thai Public Health Minister Anutin Charnvirakul said it appears to be the first confirmed case of the virus found outside China, the Bangkok Post newspaper and other Thai media reported. He identified the infected tourist as a 61-year-old woman whose symptoms were detected on arrival at Bangkok’s Suvarnabhumi Airport last Wednesday. Her coronavirus was confirmed Sunday by a laboratory test, Anutin said. She has been treated at an isolation ward at a state health facility outside of Bangkok, and no longer has any fever or respiratory symptoms, he said. Eight other people with possible symptoms have also been held at the facility, he said, but none has been confirmed to have the virus. A statement issued Monday by the Geneva-based World Health Organization said it is working with officials in Thailand and China following the report of the confirmed case outside China. The agency says its director-general is consulting with the agency’s emergency committee, which generally decides whether viral outbreaks merit an expanded response from health authorities. “The possibility of cases being identified in other countries was not unexpected, and reinforces why WHO calls for ongoing active monitoring and preparedness in other countries,” the agency said. “WHO reiterates that it is essential that investigations continue in China to identify the source of this outbreak and any animal reservoirs or intermediate hosts.” The virus is not believed to be spread by human-to-human contact. Officials in Wuhan said over the weekend that a total of 41 people were suffering from pneumonia caused by the new coronavirus and a 61-year-old man had died — China’s first known death from the virus. China says the cause of the Wuhan outbreak remains unknown but has sought to play down speculation that it could be a reappearance of the SARS epidemic, which killed hundreds in 2002 and 2003. Coronaviruses are a large family of viruses, some of which cause the common cold. Others found in bats, camels and other animals have evolved to cause more severe illnesses. Common symptoms include a runny nose, headache, cough and fever. Shortness of breath, chills and body aches are associated with more dangerous kinds of coronaviruses, according to the U.S. Centers for Disease Control and Prevention. https://time.com/5763805/thailand-chinese-person-hospitalized-sars-virus/
-
PDF of All Cases and Latest Statuses (Updated Daily) https://www.chp.gov.hk/files/pdf/enhanced_sur_pneumonia_wuhan_eng.pdf
-
Public hospital daily update on Wuhan-related cases ****************************************** The following is issued on behalf of the Hospital Authority: As at noon today (January 13), only Princess Margaret Hospital had admitted one patient (female, aged 38) in the past 24 hours who has been to Wuhan in the past 14 days and presented with fever, respiratory infection or pneumonia symptoms. The patient concerned has not visited wet markets in Wuhan before the onset of symptoms. Including the above-mentioned case, the Hospital Authority (HA) has reported 68 patient cases since December 31, 2019. Specimens of the patients concerned have been sent to the Department of Health (DH) for testing. Among all the suspected cases, 56 have been discharged and those patients staying in hospitals are in stable condition. The HA will maintain close contact with the Centre for Health Protection to monitor the latest developments and to inform the public and healthcare workers with the latest information in a timely manner. Ends/Monday, January 13, 2020 Issued at HKT 17:00 https://www.info.gov.hk/gia/general/202001/13/P2020011300475.htm
-
Public hospital daily update on Wuhan-related cases ****************************************** The following is issued on behalf of the Hospital Authority: As at noon today (January 12), public hospitals had admitted seven patients in the past 24 hours who have been to Wuhan in the past 14 days and presented with fever, respiratory infection or pneumonia symptoms. The patients concerned had not visited wet markets in Wuhan before the onset of symptoms. Including the above-mentioned cases, the Hospital Authority (HA) has reported 67 patient cases since December 31, 2019. Specimens of the patients concerned have been sent to the Department of Health (DH) for testing. Among all the suspected cases, 51 have been discharged and those patients staying in hospitals are in stable condition. Hospital Age Gender 1. Queen Elizabeth Hospital 56 Female 2. United Christian Hospital 38 Female 3. Queen Mary Hospital 13 Male 4. Pamela Youde Nethersole Eastern Hospital 8 Male 5. Tuen Mun Hospital 67 Female 6. Tuen Mun Hospital 67 Male 7. Prince of Wales Hospital 10 Female The HA will maintain close contact with the Centre for Health Protection to monitor the latest development and to timely inform the public and healthcare workers the latest information. Ends/Sunday, January 12, 2020 Issued at HKT 18:32 https://www.info.gov.hk/gia/general/202001/12/P2020011200647.htm
-
This thread will tally novel Coronavirus (2019-nCoV) suspect cases in Hong Kong.
-
Interviews On Novel 2019-nCoV Coronavirus In Wuhan
niman replied to niman's topic in Interviews (COVID)
Jan 13 update of sequences and confirmed case in Thailand http://recombinomics.co/thedrnimanshow/2020/01/011320.mp3 -
First death reported in China as mystery new virus spreads to Thailand Save The Wuhan Hygiene Emergency Response Team leaving the closed Huanan Seafood Wholesale Market in the city of Wuhan, where the coronavirus outbreak is thought to have originated CREDIT: NOEL CELIS/AFP/GETTY Sarah Newey Anne Gulland, deputy global health security editor 13 JANUARY 2020 • 1:02PM Follow Amystery respiratory virus which emerged in China at the beginning of the year has been found in Thailand, raising fears that the disease is not being contained. The first fatality has also been reported. The World Health Organization confirmed that a traveller from China has been diagnosed with the new coronavirus, which was first identified in Wuhan in central China earlier this month. The patient was hospitalised and is now recovering, according to Thai officials. "The possibility of cases being identified in other countries was not unexpected and reinforces why WHO calls for ongoing active monitoring and preparedness in other countries," a WHO spokesperson said. The case comes as a 61-year-old man in Wuhan became the first person to die of the new virus, while seven more remain in a critical condition after they contracted the illness linked to a seafood market. Some 41 people have been confirmed as having the virus - down from the 59 thought to be infected last week. News that Chinese authorities discovered a novel virus has already raised concerns internationally, with some fearing a repeat of the severe acute respiratory syndrome (SARS) epidemic that emerged in China in 2002. A man leaves the Wuhan Medical Treatment Centre, where a man who died from a respiratory illness was confined CREDIT: NOEL CELIS/AFP/GETTY The SARS coronavirus spread worldwide, infecting 8,000 people and killing almost 800 before it was contained. But while there is so far no sign that the new coronavirus can spread between people - and no health workers have been infected - public health experts worldwide remain on high alert. The European Centre for Disease Prevention and Control has warned that while the risk of transmission into Europe is “low”, it “cannot be excluded” because EU airports have direct and indirect flights to Wuhan. Countries in south Asia, including Thailand, Singapore and South Korea, have also introduced health screening procedures for passengers arriving from the city. In Bangkok local media reported that five people have already been quarantined after displaying symptoms similar to patients in Wuhan. And the Hong Kong Hospital Authority has said that seven patients who visited Wuhan in the last fortnight have been admitted to hospital for monitoring after developing fever, pneumonia or respiratory symptoms. But the WHO's announcement that the novel coronavirus has reached Thailand is the first confirmation that the illness has spread internationally. As a result the organisation's director general, Dr Tedros Adhanom Ghebreyesus, said he will consult emergency committee members about whether a crisis meeting should meet. Jonathan Ball, professor of molecular virology at the University of Nottingham, told The Telegraph that it was not yet clear how a case emerged in Thailand. "Until we know the likely source of their infection it’s difficult to say whether - and which - surveillance and monitoring measures have broken down. But it would be more worrying if it was a completely new source of the virus which was not linked [to Wuhan]," he said. Experts are also concerned about the timing of the outbreak. In just a few weeks millions of people will be travelling across the country and region to celebrate the Spring Festival, China’s biggest national holiday, which begins on January 25. Government estimates suggest that some three billion trips will be made. But the WHO has praised Chinese authorities for their quick identification of the new coronavirus. This is in contrast to 2002, when the country was accused of trying to cover up the SARS outbreak - with deadly consequences. Over the weekend, Chinese authorities posted the genetic sequence of the new virus online - a move welcomed by experts after criticism last week that they were slow to share details. Professor David Heymann, an infectious diseases expert at the London School of Hygiene and Tropical Medicine, underlined the importance of sharing information. "When a case of Middle East respiratory syndrome (MERS) first came to the UK in 2012 the genetic sequence of the virus had been put on the web a month earlier so doctors were able to confirm that this was the same sequence," he said. "It’s very important that the sequence is shared not only for confirming cases but also for developing diagnostic tests." Coronaviruses live in animals, but occasionally make the jump to humans. Seven of these viruses have now been found in humans including the new pneumonia, SARS and MERS, which first emerged in 2012 and has infected around 2,500 people, 800 of whom have died. While SARS was controlled within a year MERS has proved more tenacious, with nearly 200 cases reported in Saudi Arabia alone in 2019. The man who died was a “patient with other underlying health conditions”, including abdominal tumors and chronic liver disease. The Wuhan Municipal Health Commission said that 739 people who had been in close contact with patients were under medical surveillance, including 419 health workers. All the cases developed between mid and late December - no new cases have been reported since 3rd January - and are associated with the Huanan seafood market, which has since been closed and disinfected. The man who died appears to have been a regular customer at the market, which trades in birds, pheasants, rabbits and snakes as well as seafood. Public health experts have stressed that it is vital to track down which animal the infection originated in to fully understand and contain the coronavirus. “The biggest thing to ascertain is how transmissible the virus is between humans,” said Sarah Gilbert, professor of vaccinology at the Jenner Institute at Oxford University. “This will affect how easily the virus can be contained.” https://www.telegraph.co.uk/global-health/science-and-disease/first-death-reported-china-mystery-new-virus-spreads-thailand/