Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  2. Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 30, 2016) http://www.cdc.gov/zika/geo/united-states.html StatesTravel-associated cases* No. (%) (N=312)Locally acquired cases† No. (%) (N=0)Alabama2 (1)0 (0)Arizona1 (<1)0 (0)Arkansas1 (<1)0 (0)California17 (6)0 (0)Colorado2 (1)0 (0)Connecticut1 (<1)0 (0)Delaware3 (1)0 (0)District of Columbia3 (1)0 (0)Florida74 (24)0 (0)Georgia9 (3)0 (0)Hawaii5 (2)0 (0)Illinois9 (3)0 (0)Indiana5 (2)0 (0)Iowa4 (1)0 (0)Kansas1 (<1)0 (0)Kentucky3 (1)0 (0)Louisiana2 (1)0 (0)Maine1 (<1)0 (0)Maryland6 (2)0 (0)Massachusetts7 (2)0 (0)Michigan2 (1)0 (0)Minnesota12 (4)0 (0)Mississippi2 (1)0 (0)Missouri1 (<1)0 (0)Montana1 (<1)0 (0)Nebraska2 (1)0 (0)Nevada2 (<1)0 (0)New Hampshire2 (1)0 (0)New Jersey5 (1)0 (0)
  3. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  4. Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 30, 2016) http://www.cdc.gov/zika/geo/united-states.html StatesTravel-associated cases* No. (%) (N=312)Locally acquired cases† No. (%) (N=0)Alabama2 (1)0 (0)Arizona1 (<1)0 (0)Arkansas1 (<1)0 (0)California17 (6)0 (0)Colorado2 (1)0 (0)Connecticut1 (<1)0 (0)Delaware3 (1)0 (0)District of Columbia3 (1)0 (0)Florida74 (24)0 (0)Georgia9 (3)0 (0)Hawaii5 (2)0 (0)Illinois9 (3)0 (0)Indiana5 (2)0 (0)Iowa4 (1)0 (0)Kansas1 (<1)0 (0)Kentucky3 (1)0 (0)Louisiana2 (1)0 (0)Maine1 (<1)0 (0)Maryland6 (2)0 (0)Massachusetts7 (2)0 (0)Michigan2 (1)0 (0)Minnesota12 (4)0 (0)
  5. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  6. Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 30, 2016) http://www.cdc.gov/zika/geo/united-states.html StatesTravel-associated cases* No. (%) (N=312)Locally acquired cases† No. (%) (N=0)Alabama2 (1)0 (0)Arizona1 (<1)0 (0)Arkansas1 (<1)0 (0)California17 (6)0 (0)Colorado2 (1)0 (0)Connecticut1 (<1)0 (0)Delaware3 (1)0 (0)District of Columbia3 (1)0 (0)Florida74 (24)0 (0)Georgia9 (3)0 (0)Hawaii5 (2)0 (0)Illinois9 (3)0 (0)Indiana5 (2)0 (0)Iowa4 (1)0 (0)Kansas1 (<1)0 (0)Kentucky3 (1)0 (0)Louisiana2 (1)0 (0)Maine1 (<1)0 (0)Maryland6 (2)0 (0)Massachusetts7 (2)0 (0)
  7. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  8. Maryland Confirmed Zika Virus Infections (As of March 30, 2016) http://phpa.dhmh.maryland.gov/Pages/Zika.aspx Travel-AssociatedLocally Acquired Vector-BorneTotal606
  9. Maryland Confirmed Zika Virus Infections (As of March 30, 2016) Travel-AssociatedLocally Acquired Vector-BorneTotal606
  10. Map Update https://www.google.com/maps/d/u/0/edit?hl=en&hl=en&authuser=0&authuser=0&mid=zv94AJqgUct4.kT4qLMXp3SLU
  11. Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 30, 2016) http://www.cdc.gov/zika/geo/united-states.html StatesTravel-associated cases* No. (%) (N=312)Locally acquired cases† No. (%) (N=0)Alabama2 (1)0 (0)Arizona1 (<1)0 (0)Arkansas1 (<1)0 (0)California17 (6)0 (0)Colorado2 (1)0 (0)Connecticut1 (<1)0 (0)Delaware3 (1)0 (0)District of Columbia3 (1)0 (0)Florida74 (24)0 (0)Georgia9 (3)0 (0)Hawaii5 (2)0 (0)Illinois9 (3)0 (0)Indiana5 (2)0 (0)
  12. niman replied to niman's topic in Texas
    Zika Virus – March 31, 2016. Texas has had 27 confirmed cases of Zika virus disease. Of those, 26 were in travelers who were infected abroad and diagnosed after they returned home; one of those travelers was a pregnant woman. One case involved a Dallas County resident who had sexual contact with someone who acquired the Zika infection while traveling abroad. Case counts by county: Bexar – 3Dallas – 4Fort Bend – 2Grayson – 1Harris – 11Tarrant – 3Travis – 2Wise – 1
  13. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds650650100%0.0100%KU991811.1Select seq gb|KU985088.1|Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds650650100%0.0100%KU985088.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome650650100%0.0100%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome650650100%0.0100%KU940224.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds650650100%0.0100%KU955589.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome650650100%0.0100%KU870645.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome650650100%0.0100%KU926309.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds650650100%0.0100%KU866423.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome650650100%0.0100%KU820899.2Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds650650100%0.0100%KU729217.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds650650100%0.0100%KU729218.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome650650100%0.0100%KU681081.3Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome650650100%0.0100%KU527068.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds650650100%0.0100%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds650650100%0.0100%KU501216.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds650650100%0.0100%KJ634273.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds650650100%0.0100%KJ776791.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds645645100%0.099%KU955590.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome645645100%0.099%KU926310.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome645645100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome645645100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome645645100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome645645100%0.099%KU853012.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome645645100%0.099%KU497555.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds645645100%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds645645100%0.099%KU646827.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds645645100%0.099%KU647676.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome645645100%0.099%KU509998.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds645645100%0.099%KU365778.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds645645100%0.099%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds645645100%0.099%KU312314.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome645645100%0.099%KU321639.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds641641100%3e-18099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds641641100%3e-18099%KU740184.2Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds641641100%3e-18099%KU820897.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds641641100%3e-18099%KU761564.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome641641100%3e-18099%KU707826.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome641641100%3e-18099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds641641100%3e-18099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds641641100%3e-18099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds641641100%3e-18099%KU365777.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds641641100%3e-18099%KU312313.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds641641100%3e-18099%KU312312.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds641641100%3e-18099%EU545988.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome636636100%1e-17899%KU955593.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome636636100%1e-17899%KU681082.3Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome636636100%1e-17899%KU744693.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds636636100%1e-17899%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds632632100%1e-17799%KF993678.1
  14. LOCUS KU985088 360 bp RNA linear VRL 28-MAR-2016 DEFINITION Zika virus isolate MEX/InDRE/Zika-2/2015 envelope protein gene, partial cds. ACCESSION KU985088 VERSION KU985088.1 GI:1011619266 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 360) AUTHORS Diaz-Quinonez,J.A., Vazquez-Pichardo,M., Nunez-Leon,A., Torres-Rodriguez,M.D.L.L., Escobar-Escamilla,N., Wong-Arambula,C.E., Torres-Longoria,B., Lopez-Martinez,I., Ruiz-Matus,C., Kuri-Morales,P.A. and Ramirez-Gonzalez,J.E. TITLE Molecular characterization of Zika virus in Mexico JOURNAL Unpublished REFERENCE 2 (bases 1 to 360) AUTHORS Vazquez-Pichardo,M., Nunez-Leon,A., Torres-Rodriguez,M.L., Rosales-Jimenez,C., Torres-Olmos,Y.A., Perez-Meza,R., Aparicio-Antonio,A.M., Herrera-Bautista,R.M., Wong-Arambula,C.E., Rodriguez-Maldonado,A.P., Del Mazo-Lopez,J.C., Serrano-Gutierrez,S., Escobar-Escamilla,N., Torres-Longoria,B., Gomez-Bustamante,A., Lopez-Martinez,I., Ramirez-Gonzalez,J.E. and Diaz-Quinonez,J.A. TITLE Direct Submission JOURNAL Submitted (28-MAR-2016) Biologia Molecular y Validacion de Tecnicas, Instituto de Diagnostico y Referencia Epidemiologicos (InDRE), Francisco de P. Miranda 177 Col. Lomas de Plateros, Mexico, DF 01480, Mexico COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..360 /organism="Zika virus" /mol_type="genomic RNA" /isolate="MEX/InDRE/Zika-2/2015" /isolation_source="Serum" /host="Homo sapiens; 46 years old; male" /db_xref="taxon:64320" /country="Mexico: Chiapas" /collection_date="30-Nov-2015" CDS <1..>360 /codon_start=2 /product="envelope protein" /protein_id="AMR96779.1" /db_xref="GI:1011619267" /translation="RCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTC AKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSP RAEATLGGFGSLGLDCEP" ORIGIN 1 ccgctgccca acacaaggtg aagcctacct tgacaagcaa tcagacactc aatatgtctg 61 caaaagaacg ttagtggaca gaggctgggg aaatggatgt ggactttttg gcaaagggag 121 cctggtgaca tgcgctaagt ttgcatgctc caagaaaatg accgggaaga gcatccagcc 181 agagaatctg gagtaccgga taatgctgtc agttcatggc tcccagcaca gtgggatgat 241 cgttaatgac acaggacatg aaactgatga gaatagagcg aaggttgaga taacgcccaa 301 ttcaccaaga gccgaagcca ccctgggggg ttttggaagc ctaggacttg attgtgaacc
  15. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds13621362100%0.0100%KU985087.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome13621362100%0.0100%KU870645.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome13571357100%0.099%KU497555.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds13571357100%0.099%KU647676.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds13571357100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds13571357100%0.099%KU501216.1Select seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds13531353100%0.099%KU991811.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome13531353100%0.099%KU926310.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome13531353100%0.099%KU926309.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds13531353100%0.099%KU729217.2Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds13531353100%0.099%KU820897.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome13531353100%0.099%KU509998.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome13531353100%0.099%KU321639.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds13531353100%0.099%KM078936.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds13531353100%0.099%KJ776791.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds13501350100%0.099%KM078961.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome13481348100%0.099%KU940228.1Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome13481348100%0.099%KU940224.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome13481348100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome13481348100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome13481348100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome13481348100%0.099%KU853012.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome13481348100%0.099%KU707826.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome13481348100%0.099%KU527068.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome13481348100%0.099%KU501215.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds13481348100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds13481348100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds13481348100%0.099%KU365777.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds13481348100%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds13461346100%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds13461346100%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds13461346100%0.099%KM078933.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds13441344100%0.099%KU955590.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds13441344100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds13441344100%0.099%KU740184.2Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds13441344100%0.099%KU729218.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds13441344100%0.099%KU761564.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds13441344100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds13441344100%0.099%KU312312.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds13441344100%0.099%KM078929.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds1341134198%0.099%KU556802.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds13301330100%0.099%KU955589.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds13301330100%0.099%KU866423.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome13301330100%0.099%KU820899.2Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome13301330100%0.099%KU744693.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds13301330100%0.099%KF993678.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds1328132898%0.099%KJ873160.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome13261326100%0.099%KU681081.3Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds13261326100%0.099%KU179098.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome13031303100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds13031303100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds12991299100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome12811281100%0.098%KU681082.3Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds1249124992%0.099%KJ873161.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds1240124091%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds1231123190%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds1229122991%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds1220122089%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds1218121890%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds1214121489%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds1211121189%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds1211121189%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds1205120588%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds1195119588%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds1191119187%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds1187118787%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds1186118688%0.099%KU232291.1Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds11641164100%0.094%HQ234499.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds1047104778%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds1016101678%0.098%KM851038.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds969969100%0.088%KF268949.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome966966100%0.088%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds966966100%0.088%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID966966100%0.088%LC002520.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds966966100%0.088%HQ234498.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome966966100%0.088%AY632535.2Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds966966100%0.088%AF013415.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds960960100%0.088%DQ859059.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds957957100%0.088%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds957957100%0.088%KF383119.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome948948100%0.088%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome948948100%0.088%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome948948100%0.088%KU955591.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds946946100%0.088%KF268950.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds946946100%0.088%KF268948.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds939939100%0.088%KF383116.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds933933100%0.087%KF383118.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds930930100%0.087%HQ234501.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds930930100%0.087%HQ234500.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds915915100%0.087%KF383117.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds901901100%0.087%KF383115.1Select seq gb|KF383103.1|Zika virus strain ArA986 nonstructural protein 5 gene, partial cds88888891%0.088%KF383103.1Select seq gb|KF383086.1|Zika virus strain ArA975 nonstructural protein 5 gene, partial cds88888891%0.088%KF383086.1Select seq gb|KF383104.1|Zika virus strain ArA982 nonstructural protein 5 gene, partial cds85685691%0.087%KF383104.1Select seq gb|KF383085.1|Zika virus strain ArD9957 nonstructural protein 5 gene, partial cds85285291%0.087%KF383085.1Select seq gb|KF383106.1|Zika virus strain ArA27443 nonstructural protein 5 gene, partial cds84784791%0.087%KF383106.1Select seq gb|KF383114.1|Zika virus strain AnD30332 nonstructural protein 5 gene, partial cds84384391%0.087%KF383114.1Select seq gb|KF383107.1|Zika virus strain ArA27407 nonstructural protein 5 gene, partial cds84384391%0.087%KF383107.1Select seq gb|KF383088.1|Zika virus strain ArD30101 nonstructural protein 5 gene, partial cds84384391%0.087%KF383088.1Select seq gb|KF383087.1|Zika virus strain ArD30156 nonstructural protein 5 gene, partial cds83883891%0.087%KF383087.1Select seq gb|KF383089.1|Zika virus strain ArD165531 nonstructural protein 5 gene, partial cds82582591%0.086%KF383089.1Select seq gb|KF383101.1|Zika virus strain ArD127710 nonstructural protein 5 gene, partial cds82082091%0.086%KF383101.1Select seq gb|KF383097.1|Zika virus strain ArD127994 nonstructural protein 5 gene, partial cds82082091%0.086%KF383097.1Select seq gb|KF383099.1|Zika virus strain ArD127987 nonstructural protein 5 gene, partial cds81681691%0.086%KF383099.1Select seq gb|KF383098.1|Zika virus strain ArD127988 nonstructural protein 5 gene, partial cds81081091%0.086%KF383098.1Select seq gb|KF383084.1|Zika virus strain HD78788 nonstructural protein 5 gene, partial cds78978991%0.085%KF383084.1Select seq gb|KF383113.1|Zika virus strain ArA1465 nonstructural protein 5 gene, partial cds78078091%0.085%KF383113.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence762762100%0.082%KF383120.1Select seq gb|KF383092.1|Zika virus strain ArD147917 nonstructural protein 5 gene, partial cds64164191%6e-18081%KF383092.1Select seq gb|KF383093.1|Zika virus strain ArD149810 nonstructural protein 5 gene, partial cds63963991%2e-17980%KF383093.1Select seq gb|KF383095.1|Zika virus strain ArD132915 nonstructural protein 5 gene, partial cds63663691%3e-17880%KF383095.1Select seq gb|KF383091.1|Zika virus strain ArD149938 nonstructural protein 5 gene, partial cds63063091%1e-17680%KF383091.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds61861845%7e-173100%KU867812.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome33172353%2e-8699%KU940227.1
  16. LOCUS KU985087 755 bp RNA linear VRL 28-MAR-2016 DEFINITION Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds. ACCESSION KU985087 VERSION KU985087.1 GI:1011619245 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 755) AUTHORS Diaz-Quinonez,J.A., Vazquez-Pichardo,M., Nunez-Leon,A., Torres-Rodriguez,M.D.L.L., Escobar-Escamilla,N., Wong-Arambula,C.E., Torres-Longoria,B., Lopez-Martinez,I., Ruiz-Matus,C., Kuri-Morales,P.A. and Ramirez-Gonzalez,J.E. TITLE Molecular characterization of Zika virus in Mexico JOURNAL Unpublished REFERENCE 2 (bases 1 to 755) AUTHORS Vazquez-Pichardo,M., Nunez-Leon,A., Torres-Rodriguez,M.L., Rosales-Jimenez,C., Torres-Olmos,Y.A., Perez-Meza,R., Aparicio-Antonio,A.M., Herrera-Bautista,R.M., Wong-Arambula,C.E., Rodriguez-Maldonado,A.P., Del Mazo-Lopez,J.C., Serrano-Gutierrez,S., Escobar-Escamilla,N., Torres-Longoria,B., Gomez-Bustamante,A., Lopez-Martinez,I., Ramirez-Gonzalez,J.E. and Diaz-Quinonez,J.A. TITLE Direct Submission JOURNAL Submitted (28-MAR-2016) Biologia Molecular y Validacion de Tecnicas, Instituto de Diagnostico y Referencia Epidemiologicos (InDRE), Francisco de P. Miranda 177 Col. Lomas de Plateros, Mexico, DF 01480, Mexico COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..755 /organism="Zika virus" /mol_type="genomic RNA" /isolate="MEX/InDRE/Zika-2/2015" /isolation_source="Serum" /host="Homo sapiens; 46 years old; male" /db_xref="taxon:64320" /country="Mexico: Chiapas" /collection_date="30-Nov-2015" CDS <1..>755 /codon_start=1 /product="nonstructural protein 5" /protein_id="AMR96778.1" /db_xref="GI:1011619246" /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSCIPGGRM YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW EEVPFCSHHFNKLHLKDGRSIVVPCRHQDELIGR" ORIGIN 1 gaagcccttg gattcttgaa cgaggatcac tggatgggga gagagaactc aggaggtggt 61 gttgaagggc tgggattaca aagactcgga tatgtcctag aagagatgag ttgcatacca 121 ggaggaagga tgtatgcaga tgacactgct ggctgggaca cccgcatcag caggtttgat 181 ctggagaatg aagctctaat caccaaccaa atggagaaag ggcacagggc cttggcattg 241 gccataatca agtacacata ccaaaacaaa gtggtaaagg tccttagacc agctgaaaaa 301 gggaaaacag ttatggacat tatttcgaga caagaccaaa gggggagcgg acaagttgtc 361 acttacgctc ttaacacatt taccaaccta gtggtgcaac tcattcggaa tatggaggct 421 gaggaagttc tagagatgca agacttgtgg ctgctgcgga ggtcagagaa agtgaccaac 481 tggttgcaga gcaacggatg ggataggctc aaacgaatgg cagtcagtgg agatgattgc 541 gttgtgaagc caattgatga taggtttgca catgccctca ggttcttgaa tgatatggga 601 aaagttagga aggacacaca agagtggaaa ccctcaactg gatgggacaa ctgggaagaa 661 gttccgtttt gctcccacca cttcaacaag ctccatctca aggacgggag gtccattgtg 721 gttccctgcc gccaccaaga tgaactgatt ggccg
  17. InDRE released two partial Zika sequences from 46M in Chiapas,Mexico collected Nov 30, 2015 which exactly matches sequence from fetal brain collected from Washington DC traveler (FB-GWUH/2016), infected while on vacation (Nov 2015) that included travel to Mexico and Guatemala.
  18. As of March 30, 2016 (5 am EST) Zika virus disease and Zika virus congenital infection are nationally notifiable conditions.This update from the CDC Arboviral Disease Branch includes provisional data reported to ArboNET for January 1, 2015 – March 30, 2016.US States Travel-associated Zika virus disease cases reported: 312Locally acquired vector-borne cases reported: 0Of the 312 cases reported, 27 were pregnant women, 6 were sexually transmitted, and 1 had Guillain-Barré syndromeUS Territories Travel-associated cases reported: 3Locally acquired cases reported: 349Of the 352 cases reported, 37 were pregnant women and 1 had Guillain-Barré syndrome Laboratory-confirmed Zika virus disease cases reported to ArboNET by state or territory — United States, 2015–2016 (as of March 30, 2016) StatesTravel-associated cases* No. (%) (N=312)Locally acquired cases† No. (%) (N=0)Alabama2 (1)0 (0)Arizona1 (<1)0 (0)Arkansas1 (<1)0 (0)California17 (6)0 (0)Colorado2 (1)0 (0)Connecticut1 (<1)0 (0)Delaware3 (1)0 (0)District of Columbia3 (1)0 (0)Florida74 (24)0 (0)Georgia9 (3)0 (0)Hawaii5 (2)0 (0)Illinois9 (3)0 (0)Indiana5 (2)0 (0)Iowa4 (1)0 (0)Kansas1 (<1)0 (0)Kentucky3 (1)0 (0)Louisiana2 (1)0 (0)Maine1 (<1)0 (0)Maryland6 (2)0 (0)Massachusetts7 (2)0 (0)Michigan2 (1)0 (0)Minnesota12 (4)0 (0)Mississippi2 (1)0 (0)Missouri1 (<1)0 (0)Montana1 (<1)0 (0)Nebraska2 (1)0 (0)Nevada2 (<1)0 (0)New Hampshire2 (1)0 (0)New Jersey5 (1)0 (0)New York46 (15)0 (0)North Carolina7 (2)0 (0)Ohio9 (3)0 (0)Oklahoma3 (1)0 (0)Oregon6 (2)0 (0)Pennsylvania11 (4)0 (0)Tennessee1 (<1)0 (0)Texas27 (9)0 (0)Utah2 (1)0 (0)Virginia8 (3)0 (0)Washington2 (1)0 (0)West Virginia5 (2)0 (0) Territories(N=3)(N=349)American Samoa0 (0)14 (4)Puerto Rico2 (67)325 (93)US Virgin Islands1 (33)10 (3)*Travelers returning from affected areas, their sexual contacts, or infants infected in utero †Presumed local mosquito-borne transmission Page last reviewed: February 4, 2016Page last updated: March 30, 2016
  19. DescriptionsSequences producing significant alignments:Select:AllNone Selected:0AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU991811.1|Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds1852518525100%0.0100%KU991811.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1842918429100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1842618426100%0.099%KJ776791.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1841718417100%0.099%KU321639.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1840818408100%0.099%KU729218.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome184081840899%0.099%KU497555.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1840818408100%0.099%KU707826.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1840818408100%0.099%KU647676.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1840818408100%0.099%KU365779.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1839318393100%0.099%KU926309.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1839318393100%0.099%KU820897.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1839318393100%0.099%KU365780.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1839018390100%0.099%KU940228.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1839018390100%0.099%KU922960.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1839018390100%0.099%KU365777.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1838418384100%0.099%KU922923.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1838418384100%0.099%KU501217.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1838418384100%0.099%KU365778.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1838118381100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1838118381100%0.099%KU527068.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1838118381100%0.099%KU501216.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1837518375100%0.099%KU312312.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1836618366100%0.099%KU926310.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1836618366100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1836618366100%0.099%KU853012.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1836618366100%0.099%KU501215.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1836318363100%0.099%KU870645.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1835718357100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1834818348100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1834818348100%0.099%KU761564.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1834518345100%0.099%KU955590.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1832118321100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1832118321100%0.099%KU820899.2Select seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome182941829499%0.099%KU940224.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1821318213100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1819118191100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1809218092100%0.099%KU681081.3Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1778617786100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds177841778499%0.098%JN860885.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds177391773998%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1764017640100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1748317483100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds164751647599%0.096%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1331113311100%0.089%KF383115.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1330613306100%0.089%KF268949.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1330413304100%0.089%KU720415.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1329913299100%0.089%KU955595.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132991329999%0.089%HQ234498.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1329713297100%0.089%KF268948.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1329013290100%0.089%KU955592.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1329013290100%0.089%KF268950.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1328613286100%0.089%KF383119.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1328113281100%0.089%LC002520.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1327513275100%0.089%DQ859059.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1327213272100%0.089%KU955591.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1326513265100%0.089%KU955594.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1326113261100%0.089%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds132451324599%0.089%HQ234501.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1322313223100%0.089%AY632535.2Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1318213182100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds131741317499%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1296313031100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128821288297%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence108531085397%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50381445587%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4980498027%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4953495327%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4659465925%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4650465025%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3434343418%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3214321417%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2856416495%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2700270014%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2057205711%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2017201711%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds174617469%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds174517459%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds174317439%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173917399%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173917399%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173917399%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds173717379%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds159715978%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds141514157%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds138213827%0.099%KM851039.1Select seq gb|KU985087.1|Zika virus isolate MEX/InDRE/Zika-2/2015 nonstructural protein 5 gene, partial cds135313537%0.099%KU985087.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134613467%0.099%KU556802.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1310131010%0.088%AF013415.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds124012406%0.099%KU232300.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds124012406%0.099%KT200609.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds123112316%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122912296%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds122012206%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121812186%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds121412146%0.099%KU232298.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds121112116%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119511956%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds118611866%0.099%KU232291.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds113911396%0.099%KU758878.1Select seq gb|KF270886.1|Zika virus strain CCB-870 envelope glycoprotein gene, partial cds107710778%0.089%KF270886.1Select seq gb|AF372422.1|AF372422Zika virus envelope protein (E) gene, partial cds102010208%0.087%AF372422.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds101210125%0.099%KU867812.1Select seq gb|KF270887.1|Zika virus strain CCB-870 NS3 protein gene, partial cds9969967%0.089%KF270887.1Select seq gb|KF383022.1|Zika virus strain ArD127988 envelope protein gene, partial cds9809807%0.089%KF383022.1Select seq gb|EF158064.1|St. Louis encephalitis virus strain GML 902612 polyprotein gene, partial cds980193161%0.070%EF158064.1Select seq gb|KF383026.1|Zika virus strain ArD127994 envelope protein gene, partial cds9759757%0.089%KF383026.1Select seq gb|KF383032.1|Zika virus strain ArD30101 envelope protein gene, partial cds9669667%0.088%KF383032.1Select seq gb|KF383034.1|Zika virus strain ArD30156 envelope protein gene, partial cds9629627%0.088%KF383034.1Select seq gb|KF383029.1|Zika virus strain ArD165522 envelope protein gene, partial cds9629627%0.088%KF383029.1Select seq gb|EU303241.1|Zika virus note MR766 (p4 15/9/76) nonstructural protein 5 (NS5) gene, partial cds9629627%0.088%EU303241.1Select seq gb|KF383037.1|Zika virus strain ArA506 envelope protein gene, partial cds9609607%0.088%KF383037.1Select seq gb|KF383036.1|Zika virus strain ArA975 envelope protein gene, partial cds9579577%0.088%KF383036.1Select seq gb|KF383033.1|Zika virus strain AnD30332 envelope protein gene, partial cds9579577%0.088%KF383033.1Select seq gb|KF383039.1|Zika virus strain HD78788 envelope protein gene, partial cds9399397%0.088%KF383039.1Select seq gb|KF383028.1|Zika virus strain ArD165531 envelope protein gene, partial cds9399397%0.088%KF383028.1Select seq gb|KF383031.1|Zika virus strain ArD9957 envelope protein gene, partial cds9359357%0.088%KF383031.1Select seq gb|KF383038.1|Zika virus strain ArA986 envelope protein gene, partial cds9309307%0.087%KF383038.1Select seq gb|KF383046.1|Zika virus strain ArA982 envelope protein gene, partial cds9219217%0.087%KF383046.1Select seq gb|EU566860.1|St. Louis encephalitis virus strain Hubbard, complete genome915199857%0.069%EU566860.1Select seq gb|KT823415.1|St. Louis encephalitis virus strain RT 121B polyprotein gene, complete cds913189465%0.069%KT823415.1Select seq gb|FJ753286.2|St. Louis encephalitis virus strain CbaAr-4005, complete genome913191165%0.069%FJ753286.2Select seq gb|EF158062.1|St. Louis encephalitis virus strain FL 79-411 polyprotein gene, partial cds913198059%0.069%EF158062.1Select seq gb|EF158058.1|St. Louis encephalitis virus strain Kern 217 polyprotein gene, partial cds913195559%0.069%EF158058.1Select seq gb|DQ525916.1|St. Louis encephalitis virus strain Kern217, complete genome913195559%0.069%DQ525916.1Select seq gb|KF383045.1|Zika virus strain ArA27106 envelope protein gene, partial cds9069067%0.087%KF383045.1Select seq gb|KF383043.1|Zika virus strain ArA27443 envelope protein gene, partial cds9029027%0.087%KF383043.1Select seq gb|KF383035.1|Zika virus strain MR1429 envelope protein gene, partial cds9019017%0.086%KF383035.1Select seq gb|EF158067.1|St. Louis encephalitis virus strain BeAn 247377 polyprotein gene, partial cds899202664%0.069%EF158067.1Select seq gb|KF383103.1|Zika virus strain ArA986 nonstructural protein 5 gene, partial cds8978976%0.088%KF383103.1Select seq gb|KF383086.1|Zika virus strain ArA975 nonstructural protein 5 gene, partial cds8978976%0.088%KF383086.1Select seq gb|KF383041.1|Zika virus strain ArA27290 envelope protein gene, partial cds8978977%0.087%KF383041.1Select seq gb|KF383042.1|Zika virus strain ArA27096 envelope protein gene, partial cds8938937%0.086%KF383042.1Select seq gb|KF589299.1|St. Louis encephalitis virus strain FLU3632 polyprotein gene, complete cds886189064%0.069%KF589299.1Select seq gb|FJ753287.2|St. Louis encephalitis virus strain 79V-2533, complete genome881180563%0.069%FJ753287.2Select seq gb|KF383040.1|Zika virus strain ArA27101 envelope protein gene, partial cds8668667%0.086%KF383040.1Select seq gb|KF383104.1|Zika virus strain ArA982 nonstructural protein 5 gene, partial cds8658656%0.087%KF383104.1Select seq gb|KF383085.1|Zika virus strain ArD9957 nonstructural protein 5 gene, partial cds8658656%0.087%KF383085.1Select seq gb|KF383106.1|Zika virus strain ArA27443 nonstructural protein 5 gene, partial cds8618616%0.087%KF383106.1Select seq gb|KF383114.1|Zika virus strain AnD30332 nonstructural protein 5 gene, partial cds8568566%0.087%KF383114.1Select seq gb|KF383107.1|Zika virus strain ArA27407 nonstructural protein 5 gene, partial cds8568566%0.087%KF383107.1Select seq gb|KF383088.1|Zika virus strain ArD30101 nonstructural protein 5 gene, partial cds8568566%0.087%KF383088.1Select seq gb|KF383087.1|Zika virus strain ArD30156 nonstructural protein 5 gene, partial cds8528526%0.087%KF383087.1Select seq gb|KF383089.1|Zika virus strain ArD165531 nonstructural protein 5 gene, partial cds8388386%0.086%KF383089.1Select seq gb|KF383101.1|Zika virus strain ArD127710 nonstructural protein 5 gene, partial cds8348346%0.086%KF383101.1Select seq gb|KF383097.1|Zika virus strain ArD127994 nonstructural protein 5 gene, partial cds8348346%0.086%KF383097.1Select seq dbj|AB908162.1|Zika virus gene for polyprotein, partial cds, strain: ZIKV Hu/Tahiti/01u/2014NIID8348344%0.099%AB908162.1Select seq gb|KF383099.1|Zika virus strain ArD127987 nonstructural protein 5 gene, partial cds8298296%0.086%KF383099.1Select seq gb|KF383098.1|Zika virus strain ArD127988 nonstructural protein 5 gene, partial cds8258256%0.086%KF383098.1Select seq gb|KU872850.1|Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds8238234%0.099%KU872850.1
  20. LOCUS KU991811 10643 bp RNA linear VRL 29-MAR-2016 DEFINITION Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds. ACCESSION KU991811 VERSION KU991811.1 GI:1012128960 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10643) AUTHORS Carletti,F., Meschi,S., Castilletti,C., Zaccaro,P., Ferraioli,V., Quartu,S., Colavita,F., Corpolongo,A., Nicastri,E., Di Caro,A., Ippolito,G. and Capobianchi,M.R. TITLE Isolation of infectious Zika virus from sera in a traveller returning from Brazil to Italy JOURNAL Unpublished REFERENCE 2 (bases 1 to 10643) AUTHORS Carletti,F., Meschi,S., Castilletti,C., Zaccaro,P., Ferraioli,V., Quartu,S., Colavita,F., Corpolongo,A., Nicastri,E., Di Caro,A., Ippolito,G. and Capobianchi,M.R. TITLE Direct Submission JOURNAL Submitted (23-MAR-2016) Virology Laboratory, INMI L. Spallanzani, Via Portuense 292, Rome 00149, Italy COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10643 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Brazil/2016/INMI1" /host="Homo sapiens" /db_xref="taxon:64320" /country="Italy: Rome" /collection_date="06-Mar-2016" CDS 74..10345 /codon_start=1 /product="polyprotein" /protein_id="AMS00611.1" /db_xref="GI:1012128961" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMEGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVDCFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 tcgagtttga agcgaaagct agcaacagta tcaacaggtt ttattttgga tttggaaacg 61 agagtttctg gtcatgaaaa acccaaaaaa gaaatccgga ggattccgga ttgtcaatat 121 gctaaaacgc ggagtagccc gtgtgagccc ctttgggggc ttgaagaggc tgccagccgg 181 acttctgctg ggtcatgggc ccatcaggat ggtcttggcg attctagcct ttttgagatt 241 cacggcaatc aagccatcac tgggtctcat caatagatgg ggttcagtgg ggaaaaaaga 301 ggctatggaa ataataaaga agttcaagaa agatctggct gccatgctga gaataatcaa 361 tgctaggaag gagaagaaga gacgaggcgc agatactagt gtcggaattg ttggcctcct 421 gctgaccaca gctatggcag cggaggtcac tagacgtggg agtgcatact atatgtactt 481 ggacagaaac gatgctgggg aggccatatc ttttccaacc acattgggga tgaataagtg 541 ttatatacag atcatggatc ttggacacat gtgtgatgcc accatgagct atgaatgccc 601 tatgctggat gagggggtgg aaccagatga cgtcgattgt tggtgcaaca cgacgtcaac 661 ttgggttgtg tacggaacct gccatcacaa aaaaggtgaa gcacggagat ctagaagagc 721 tgtgacgctc ccctcccatt ccactaggaa gctgcaaacg cggtcgcaaa cctggttgga 781 atcaagagaa tacacaaagc acttgattag agtcgaaaat tggatattca ggaaccctgg 841 cttcgcgtta gcagcagctg ccatcgcttg gcttttggga agctcaacga gccaaaaagt 901 catatacttg gtcatgatac tgctgattgc cccggcatac agcatcaggt gcataggagt 961 cagcaatagg gactttgtgg aaggtatgtc aggtgggact tgggttgatg ttgtcttgga 1021 acatgggggt tgtgtcaccg taatggcaca ggacaaaccg actgtcgaca tagagctggt 1081 tacaacaaca gtcagcaaca tggcggaggt aagatcctac tgctatgagg catcaatatc 1141 agacatggct tcggacagcc gctgcccaac acaaggtgaa gcctaccttg acaagcaatc 1201 agacactcaa tatgtctgca aaagaacgtt agtggacaga ggctggggaa atggatgtgg 1261 actttttggc aaagggagcc tggtgacatg cgctaagttt gcatgctcca agaaaatgac 1321 cgggaagagc atccagccag agaatctgga gtaccggata atgctgtcag ttcatggctc 1381 ccagcacagt gggatgatcg ttaatgacac aggacatgaa actgatgaga atagagcgaa 1441 ggttgagata acgcccaatt caccaagagc cgaagccacc ctggggggtt ttggaagcct 1501 aggacttgat tgtgaaccga ggacaggcct tgacttttca gatttgtatt acttgactat 1561 gaataacaag cactggttgg ttcacaagga gtggttccac gacattccat taccttggca 1621 cgctggggca gacaccggaa ctccacactg gaacaacaaa gaagcactgg tagagttcaa 1681 ggacgcacat gccaaaaggc aaactgtcgt ggttctaggg agtcaagaag gagcagttca 1741 cacggccctt gctggagctc tggaggctga gatggatggt gcaaagggaa ggctgtcctc 1801 tggccacttg aaatgtcgcc tgaaaatgga taaacttaga ttgaagggcg tgtcatactc 1861 cttgtgtacc gcagcgttca cattcaccaa gatcccggct gaaacactgc acgggacagt 1921 cacagtggag gtacagtacg cagggacaga tggaccttgc aaggttccag ctcagatggc 1981 ggtggacatg caaactctga ccccagttgg gaggttgata accgctaacc ccgtaatcac 2041 tgaaagcact gagaactcta agatgatgct ggaacttgat ccaccatttg gggactctta 2101 cattgtcata ggagtcgggg agaagaagat cacccaccac tggcacagga gtggcagcac 2161 cattggaaaa gcatttgaag ccactgtgag aggtgccaag agaatggcag tcttgggaga 2221 cacagcctgg gactttggat cagttggagg cgctctcaac tcattgggca agggcatcca 2281 tcaaattttt ggagcagctt tcaaatcatt gtttggagga atgtcctggt tctcacaaat 2341 tctcattgga acgttgctga tgtggttggg tctgaacaca aagaatggat ctatttccct 2401 tatgtgcttg gccttagggg gagtgttgat cttcttatcc acagccgtct ctgctgatgt 2461 ggggtgttcg gtggacttct caaagaagga gacgagatgt ggtacagggg tgttcgtcta 2521 taacgacgtt gaagcctgga gggacaggta caagtaccat cctgactccc cccgtagatt 2581 ggcagcagca gtcaagcaag cctgggaaga tggtatctgc gggatctcct ctgtttcaag 2641 aatggaaaat atcatgtgga gatcagtaga aggggagctc aacgcaatcc tggaagagaa 2701 tggagttcaa ctgacggtcg ttgtgggatc tgtaaaaaac cccatgtgga gaggtccaca 2761 gagattgccc gtgcctgtga acgagctgcc ccacggctgg aaggcttggg ggaaatcgta 2821 cttcgtcaga gcagcaaaga caaataacag ctttgtcgtg gatggtgaca cactgaagga 2881 atgcccactc aaacatagag catggaacag ctttcttgtg gaggatcatg ggttcggggt 2941 atttcacact agtgtctggc tcaaggttag agaagattat tcattagagt gtgatccagc 3001 cgttattgga acagctgtta agggaaagga ggctgtacac agtgatctag gctactggat 3061 tgagagtgag aagaatgaca catggaggct gaagagggcc catctgatcg agatgaaaac 3121 atgtgaatgg ccaaagtccc acacattgtg gacagatgga atagaagaga gtgatctgat 3181 catacccaag tctttagctg ggccactcag ccatcacaat accagagagg gctacaggac 3241 ccaaatggaa gggccatggc acagtgaaga gcttgaaatt cggtttgagg aatgcccagg 3301 cactaaggtc cacgtggagg aaacatgtgg aacaagagga ccatctctga gatcaaccac 3361 tgcaagcgga agggtgatcg aggaatggtg ctgcagggag tgcacaatgc ccccactgtc 3421 gttccgggct aaagatggct gttggtatgg aatggagata aggcccagga aagaaccaga 3481 aagcaactta gtaaggtcaa tggtgactgc aggatcaact gatcacatgg atcacttctc 3541 ccttggagtg cttgtgattc tgctcatggt gcaggaaggg ctgaagaaga gaatgaccac 3601 aaagatcatc ataagcacat caatggcagt gctggtagct atgatcctgg gaggattttc 3661 aatgagtgac ctggctaagc ttgcaatttt gatgggtgcc accttcgcgg aaatgaacac 3721 tggaggagat gtagctcatc tggcgctgat agcggcattc aaagtcagac cagcgttgct 3781 ggtatctttc atcttcagag ctaattggac accccgtgaa agcatgctgc tggccttggc 3841 ctcgtgtctt ttgcaaactg cgatctccgc cttggaaggc gacctgatgg ttctcatcaa 3901 tggttttgct ttggcctggt tggcaatacg agcgatggtt gttccacgca ctgacaacat 3961 caccttggca atcctggctg ctctgacacc actggcccgg ggcacactgc ttgtggcgtg 4021 gagagcaggc cttgctactt gcggggggtt tatgctcctc tctctgaagg gaaaaggcag 4081 tgtgaagaag aacttaccat ttgtcatggc cctgggacta accgctgtga ggctggtcga 4141 ccccatcaac gtggtgggac tgctgttgct cacaaggagt gggaagcgga gctggccccc 4201 tagcgaagta ctcacagctg ttggcctgat atgcgcattg gctggagggt tcgccaaggc 4261 agatatagag atggctgggc ccatggccgc ggtcggtctg ctaattgtca gttacgtggt 4321 ctcaggaaag agtgtggaca tgtacattga aagagcaggt gacatcacat gggaaaaaga 4381 tgcggaagtc actggaaaca gtccccggct cgatgtggcg ctagatgaga gtggtgattt 4441 ctccctggtg gaggatgacg gtccccccat gagagagatc atactcaagg tggtcctgat 4501 gaccatctgt ggcatgaacc caatagccat accctttgca gctggagcgt ggtacgtata 4561 cgtgaagact ggaaaaagga gtggtgctct atgggatgtg cctgctccca aggaagtaaa 4621 aaagggggag accacagatg gagtgtacag agtaatgact cgcagactgc taggttcaac 4681 acaagttgga gtgggagtta tgcaagaggg ggtctttcac actatgtggc acgtcacaaa 4741 aggatccgcg ctgagaagcg gtgaagggag acttgatcca tactggggag atgtcaagca 4801 ggatctggtg tcatactgtg gtccgtggaa gctagatgcc gcctgggacg ggcacagcga 4861 ggtgcagctc ttggccgtgc cccccggaga gagagcgagg aacatccaga ctctgcccgg 4921 aatatttaag acaaaggatg gggacattgg agcggttgcg ctggattacc cagcaggaac 4981 ttcaggatct ccaatcctag acaagtgtgg gagagtgata ggactttatg gcaatggggt 5041 cgtgatcaaa aatgggagtt atgttagtgc catcacccaa gggaggaggg aggaagagac 5101 tcctgttgat tgcttcgagc cttcgatgct gaagaagaag cagctaactg tcttagactt 5161 gcatcctgga gctgggaaaa ccaggagagt tcttcctgaa atagtccgtg aagccataaa 5221 aacaagactc cgtactgtga tcttagctcc aaccagggtt gtcgctgctg aaatggagga 5281 agcccttaga gggcttccag tgcgttatat gacaacagca gtcaatgtca cccactctgg 5341 aacagaaatc gtcgacttaa tgtgccatgc caccttcact tcacgtctac tacagccaat 5401 cagagtcccc aactataatc tgtatattat ggatgaggcc cacttcacag atccctcaag 5461 tatagcagca agaggataca tttcaacaag ggttgagatg ggcgaggcgg ctgccatctt 5521 catgaccgcc acgccaccag gaacccgtga cgcatttccg gactccaact caccaattat 5581 ggacaccgaa gtggaagtcc cagagagagc ctggagctca ggctttgatt gggtgacgga 5641 tcattctgga aaaacagttt ggtttgttcc aagcgtgagg aacggcaatg agatcgcagc 5701 ttgtctgaca aaggctggaa aacgggtcat acagctcagc agaaagactt ttgagacaga 5761 gttccagaaa acaaaacatc aagagtggga ctttgtcgtg acaactgaca tttcagagat 5821 gggcgccaac tttaaagctg accgtgtcat agattccagg agatgcctaa agccggtcat 5881 acttgatggc gagagagtca ttctggctgg acccatgcct gtcacacatg ccagcgctgc 5941 ccagaggagg gggcgcatag gcaggaatcc caacaaacct ggagatgagt atctgtatgg 6001 aggtgggtgc gcagagactg acgaagacca tgcacactgg cttgaagcaa gaatgctcct 6061 tgacaatatt tacctccaag atggcctcat agcctcgctc tatcgacctg aggccgacaa 6121 agtagcagcc attgagggag agttcaagct taggacggag caaaggaaga cctttgtgga 6181 actcatgaaa agaggagatc ttcctgtttg gctggcctat caggttgcat ctgccggaat 6241 aacctacaca gatagaagat ggtgctttga tggcacgacc aacaacacca taatggaaga 6301 cagtgtgccg gcagaggtgt ggaccagaca cggagagaaa agagtgctca aaccgaggtg 6361 gatggacgcc agagtttgtt cagatcatgc ggccctgaag tcattcaagg agtttgccgc 6421 tgggaaaaga ggagcggctt ttggagtgat ggaagccctg ggaacactgc caggacacat 6481 gacagagaga ttccaggaag ccattgacaa cctcgctgtg ctcatgcggg cagagactgg 6541 aagcaggcct tacaaagccg cggcggccca attgccggag accctagaga ccattatgct 6601 tttggggttg ctgggaacag tctcgctggg aatctttttc gtcttgatga ggaacaaggg 6661 catagggaag atgggctttg gaatggtgac tcttggggcc agcgcatggc tcatgtggct 6721 ctcggaaatt gagccagcca gaattgcatg tgtcctcatt gttgtgttcc tattgctggt 6781 ggtgctcata cctgagccag aaaagcaaag atctccccag gacaaccaaa tggcaatcat 6841 catcatggta gcagtaggtc ttctgggctt gattaccgcc aatgaactcg gatggttgga 6901 gagaacaaag agtgacctaa gccatctaat gggaaggaga gaggaggggg caaccatagg 6961 attctcaatg gacattgacc tgcggccagc ctcagcttgg gccatctatg ctgccttgac 7021 aactttcatt accccagccg tccaacatgc agtgaccact tcatacaaca actactcctt 7081 aatggcgatg gccacgcaag ctggagtgtt gtttggtatg ggcaaaggga tgccattcta 7141 cgcatgggac tttggagtcc cgctgctaat gataggttgc tactcacaat taacacccct 7201 gaccctaata gtggccatca ttttgctcgt ggcgcactac atgtacttga tcccagggct 7261 gcaggcagca gctgcgcgtg ctgcccagaa gagaacggca gctggcatca tgaagaaccc 7321 tgttgtggat ggaatagtgg tgactgacat tgacacaatg acaattgacc cccaagtgga 7381 gaaaaagatg ggacaggtgc tactcatagc agtagccgtc tccagcgcca tactgtcgcg 7441 gaccgcctgg gggtgggggg aggctggggc cctgatcaca gccgcaactt ccactttgtg 7501 ggaaggctct ccgaacaagt actggaactc ctctacagcc acttcactgt gtaacatttt 7561 taggggaagt tacttggctg gagcttctct aatctacaca gtaacaagaa acgctggctt 7621 ggtcaagaga cgtgggggtg gaacaggaga gaccctggga gagaaatgga aggcccgctt 7681 gaaccagatg tcggccctgg agttctactc ctacaaaaag tcaggcatca ccgaggtgtg 7741 cagagaagag gcccgccgcg ccctcaagga cggtgtggca acgggaggcc atgctgtgtc 7801 ccgaggaagt gcaaagctga gatggttggt ggagcgggga tacctgcagc cctatggaaa 7861 ggtcattgat cttggatgtg gcagaggggg ctggagttac tacgccgcca ccatccgcaa 7921 agttcaagaa gtgaaaggat acacaaaagg aggccctggt catgaagaac ccgtgttggt 7981 gcaaagctat gggtggaaca tagtccgtct taagagtggg gtggacgtct ttcatatggc 8041 ggctgagccg tgtgacacgt tgctgtgtga cataggtgag tcatcatcta gtcctgaagt 8101 ggaagaagca cggacgctca gagtcctctc catggtgggg gattggcttg aaaaaagacc 8161 aggagccttt tgtataaaag tgttgtgccc atacaccagc actatgatgg aaaccctgga 8221 gcgactgcag cgtaggtatg ggggaggact ggtcagagtg ccactctccc gcaactctac 8281 acatgagatg tactgggtct ctggagcgaa aagcaacacc ataaaaagtg tgtccaccac 8341 gagccagctc ctcttggggc gcatggacgg gcctaggagg ccagtgaaat atgaggagga 8401 tgtgaatctc ggctctggca cgcgggctgt ggtaagctgc gctgaagctc ccaatatgaa 8461 gatcattggt aaccgcattg aaaggatccg cagtgagcac gcggaaacgt ggttctttga 8521 cgagaaccac ccatatagga catgggctta ccatggaagc tatgaggccc ccacacaagg 8581 gtcagcgtcc tctctaataa acggggttgt caggctcctg tcaaaaccct gggatgtggt 8641 gactggagtc acaggaatag ccatgaccga caccacaccg tatggtcagc aaagagtttt 8701 caaggaaaaa gtggacacta gggtgccaga cccccaagaa ggcactcgtc aggttatgag 8761 catggtctct tcctggttgt ggaaagagct aggcaaacac aaacggccac gagtctgtac 8821 caaagaagag ttcatcaaca aggttcgtag caatgcagca ttaggggcaa tatttgaaga 8881 ggaaaaagag tggaagactg cagtggaagc tgtgaacgat ccaaggttct gggctctagt 8941 ggacaaggaa agagagcacc acctgagagg agagtgccag agttgtgtgt acaacatgat 9001 gggaaaaaga gaaaagaaac aaggggaatt tggaaaggcc aagggcagcc gcgccatctg 9061 gtatatgtgg ctaggggcta gatttctaga gttcgaagcc cttggattct tgaacgagga 9121 tcactggatg gggagagaga actcaggagg tggtgttgaa gggctgggat tacaaagact 9181 cggatatgtc ctagaagaga tgagtcgcat accaggagga aggatgtatg cagatgacac 9241 tgctggctgg gatacccgca tcagcaggtt tgatctggag aatgaagctc taatcaccaa 9301 ccaaatggag aaagggcaca gggccttggc attggccata atcaagtaca cataccaaaa 9361 caaagtggta aaggtcctta gaccagctga aaaagggaaa acagttatgg acattatttc 9421 gagacaagac caaaggggga gcggacaagt tgtcacttac gctcttaaca catttaccaa 9481 cctagtggtg caactcattc ggaatatgga ggctgaggaa gttctagaga tgcaagactt 9541 gtggctgctg cggaggtcag agaaagtgac caactggttg cagagcaacg gatgggatag 9601 gctcaaacga atggcagtca gtggagatga ttgcgttgtg aagccaattg atgataggtt 9661 tgcacatgcc ctcaggttct tgaatgatat gggaaaagtt aggaaggaca cacaagagtg 9721 gaaaccctca actggatggg acaactggga agaagttccg ttttgctccc accacttcaa 9781 caagctccat ctcaaggacg ggaggtccat tgtggttccc tgccgccacc aagatgaact 9841 gattggccgg gcccgcgtct ctccaggggc gggatggagc atccgggaga ctgcttgcct 9901 agcaaaatca tatgcgcaga tgtggcagct cctttatttc cacagaaggg acctccgact 9961 gatggccaat gccatttgtt catctgtgcc agttgactgg gttccaactg ggagaactac 10021 ctggtcaatc catggaaagg gagaatggat gaccactgaa gacatgcttg tggtgtggaa 10081 cagagtgtgg attgaggaga acgaccacat ggaagacaag accccagtta cgaaatggac 10141 agacattccc tatttgggaa aaagggaaga cttgtggtgt ggatctctca tagggcacag 10201 accgcgcacc acctgggctg agaacattaa aaacacagtc aacatggtgc gcaggatcat 10261 aggtgatgaa gaaaagtaca tggactacct atccacccaa gttcgctact tgggtgaaga 10321 agggtctaca cctggagtgc tgtaagcacc aatcttaatg ttgtcaggcc tgctagtcag 10381 ccacagcttg gggaaagctg tgcagcctgt gaccctccca ggagaagctg ggaaaccaag 10441 cctatagtca ggccgagaac gccatggcac ggaagaagcc atgctgcctg tgagcccctc 10501 agaggacact gagtcaaaaa accccacgcg cttggaggcg caggatggga aaagaaggtg 10561 gcgaccttcc ccacccttca atctggggcc tgaactggag atcagctgtg gatctccaga 10621 agagggacta gtggttagag gag
  21. Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cdsGenBank: KU991811.1 http://www.ncbi.nlm.nih.gov/nucleotide/1012128960?report=genbank&log$=nucltop&blast_rank=29&RID=FU55MP1C014
  22. REFERENCES 1 Dick GW, Kitchen SF, Haddow AJ. Zika virus. I. Isolations and serological specificity.Trans R Soc Trop Med Hyg 1952;46:509-520 CrossRef | Web of Science | Medline 2 Fauci AS, Morens DM. Zika virus in the Americas — yet another arbovirus threat. N Engl J Med 2016;374:601-604 Free Full Text | Web of Science | Medline 3 Gulland A. Zika virus is a global public health emergency, declares WHO. BMJ2016;352:i657-i657 CrossRef | Web of Science | Medline 4 Dick GW. Zika virus. II. Pathogenicity and physical properties. Trans R Soc Trop Med Hyg1952;46:521-534 CrossRef | Web of Science | Medline 5 Dick GW. Epidemiological notes on some viruses isolated in Uganda; Yellow fever, Rift Valley fever, Bwamba fever, West Nile, Mengo, Semliki forest, Bunyamwera, Ntaya, Uganda S and Zika viruses. Trans R Soc Trop Med Hyg 1953;47:13-48 CrossRef | Web of Science | Medline 6 Smithburn KC, Taylor RM, Rizk F, Kader A. Immunity to certain arthropod-borne viruses among indigenous residents of Egypt. Am J Trop Med Hyg 1954;3:9-18 Web of Science | Medline 7 Smithburn KC. Neutralizing antibodies against certain recently isolated viruses in the sera of human beings residing in East Africa. J Immunol 1952;69:223-234 Web of Science | Medline 8 MacNamara FN. Zika virus: a report on three cases of human infection during an epidemic of jaundice in Nigeria. Trans R Soc Trop Med Hyg 1954;48:139-145 CrossRef | Web of Science | Medline 9 Smithburn KC, Kerr JA, Gatne PB. Neutralizing antibodies against certain viruses in the sera of residents of India. J Immunol 1954;72:248-257 Web of Science | Medline 10 Pond WL. Arthropod-borne virus antibodies in sera from residents of South-East Asia.Trans R Soc Trop Med Hyg 1963;57:364-371 CrossRef | Medline 11 Hammon WM, Schrack WD Jr, Sather GE. Serological survey for a arthropod-borne virus infections in the Philippines. Am J Trop Med Hyg 1958;7:323-328 Web of Science | Medline 12 Smithburn KC. Neutralizing antibodies against arthropod-borne viruses in the sera of long-time residents of Malaya and Borneo. Am J Hyg 1954;59:157-163 Web of Science | Medline 13 Fagbami AH. Zika virus infections in Nigeria: virological and seroepidemiological investigations in Oyo State. J Hyg (Lond) 1979;83:213-219 CrossRef | Web of Science | Medline 14 Moore DL, Causey OR, Carey DE, et al. Arthropod-borne viral infections of man in Nigeria, 1964-1970. Ann Trop Med Parasitol 1975;69:49-64 CrossRef | Web of Science | Medline 15 Olson JG, Ksiazek TG, Suhandiman , Triwibowo . Zika virus, a cause of fever in Central Java, Indonesia. Trans R Soc Trop Med Hyg 1981;75:389-393 CrossRef | Web of Science | Medline 16 Simpson DI. Zika virus infection in man. Trans R Soc Trop Med Hyg 1964;58:335-338 CrossRef | Medline 17 Duffy MR, Chen T-H, Hancock WT, et al. Zika virus outbreak on Yap Island, Federated States of Micronesia. N Engl J Med 2009;360:2536-2543 Free Full Text | Web of Science | Medline 18 Cao-Lormeau VM, Roche C, Teissier A, et al. Zika virus, French Polynesia, South Pacific, 2013. Emerg Infect Dis 2014;20:1085-1086 Web of Science | Medline 19 Rapid risk assessment: Zika virus infection outbreak, French Polynesia. Stockholm: European Centre for Disease Prevention and Control, February 14, 2014 (http://ecdc.europa.eu/en/publications/Publications/Zika-virus-French-Polynesia-rapid-risk-assessment.pdf). 20 Mallet H-P, Vial A-L, Musso D. Bilan de L’épidémie a virus Zika en Polynésie Française, 2013-2014. May 2015 (http://www.hygiene-publique.gov.pf/IMG/pdf/no13_-_mai_2015_-_zika.pdf). 21 Oehler E, Watrin L, Larre P, et al. Zika virus infection complicated by Guillain-Barre syndrome — case report, French Polynesia, December 2013. Euro Surveill 2014;19). CrossRef | Medline 22 Dupont-Rouzeyrol M, O’Connor O, Calvez E, et al. Co-infection with Zika and dengue viruses in 2 patients, New Caledonia, 2014. Emerg Infect Dis 2015;21:381-382 CrossRef | Web of Science | Medline 23 Tognarelli J, Ulloa S, Villagra E, et al. A report on the outbreak of Zika virus on Easter Island, South Pacific, 2014. Arch Virol 2016;161:665-668 CrossRef | Web of Science | Medline 24 Roth A, Mercier A, Lepers C, et al. Concurrent outbreaks of dengue, chikungunya and Zika virus infections — an unprecedented epidemic wave of mosquito-borne viruses in the Pacific 2012-2014. Euro Surveill 2014;19). CrossRef | Medline 25 Buathong R, Hermann L, Thaisomboonsuk B, et al. Detection of Zika virus infection in Thailand, 2012-2014. Am J Trop Med Hyg 2015;93:380-383 CrossRef | Web of Science | Medline 26 Tappe D, Rissland J, Gabriel M, et al. First case of laboratory-confirmed Zika virus infection imported into Europe, November 2013. Euro Surveill 2014;19). 27 Tappe D, Nachtigall S, Kapaun A, Schnitzler P, Günther S, Schmidt-Chanasit J. Acute Zika virus infection after travel to Malaysian Borneo, September 2014. Emerg Infect Dis2015;21:911-913 CrossRef | Web of Science | Medline 28 Heang V, Yasuda CY, Sovann L, et al. Zika virus infection, Cambodia, 2010. Emerg Infect Dis 2012;18:349-351 CrossRef | Web of Science | Medline 29 Alera MT, Hermann L, Tac-An IA, et al. Zika virus infection, Philippines, 2012. Emerg Infect Dis 2015;21:722-724 CrossRef | Web of Science | Medline 30 Kwong JC, Druce JD, Leder K. Zika virus infection acquired during brief travel to Indonesia.Am J Trop Med Hyg 2013;89:516-517 CrossRef | Web of Science | Medline 31 Perkasa A, Yudhaputri F, Haryanto S, et al. Isolation of Zika virus from febrile patient, Indonesia. Emerg Infect Dis 2016 (in press). 32 Campos GS, Bandeira AC, Sardi SI. Zika virus outbreak, Bahia, Brazil. Emerg Infect Dis2015;21:1885-1886 CrossRef | Web of Science | Medline 33 Zanluca C, Melo VC, Mosimann AL, Santos GI, Santos CN, Luz K. First report of autochthonous transmission of Zika virus in Brazil. Mem Inst Oswaldo Cruz 2015;110:569-572 CrossRef | Web of Science | Medline 34 Cardoso CW, Paploski IA, Kikuti M, et al. Outbreak of exanthematous illness associated with Zika, chikungunya, and dengue viruses, Salvador, Brazil. Emerg Infect Dis2015;21:2274-2276 CrossRef | Web of Science | Medline 35 Zika virus outbreaks in the Americas. Wkly Epidemiol Rec 2015;90:609-610 Medline 36 Zika virus spreads to new areas — region of the Americas, May 2015–January 2016.MMWR Morb Mortal Wkly Rep 2016;65:55-58 CrossRef | Web of Science | Medline 37 Zika virus microcephaly and Guillain-Barré syndrome. Geneva: World Health Organization, March 17, 2016 (http://apps.who.int/iris/bitstream/10665/204633/1/zikasitrep_17Mar2016_eng.pdf). 38 Possible association between Zika virus infection and microcephaly — Brazil, 2015.MMWR Morb Mortal Wkly Rep 2016;65:59-62 CrossRef | Web of Science | Medline 39 Victora CG, Schuler-Faccini L, Matijasevich A, Ribeiro E, Pessoa A, Barros FC. Microcephaly in Brazil: how to interpret reported numbers? Lancet 2016;387:621-624 CrossRef | Web of Science | Medline 40 Jouannic JM, Friszer S, Leparc-Goffart I, Garel C, Eyrolle-Guignot D. Zika virus infection in French Polynesia. Lancet2016 March 1 (Epub ahead of print) Web of Science | Medline 41 Cauchemez S, Besnard M, Bompard P, et al. Association between Zika virus and microcephaly in French Polynesia, 2013-15: a retrospective study. Lancet2016 March 15 (Epub ahead of print) Medline 42 Diallo D, Sall AA, Diagne CT, et al. Zika virus emergence in mosquitoes in southeastern Senegal, 2011. PLoS One 2014;9:e109442-e109442 CrossRef | Web of Science | Medline 43 Marchette NJ, Garcia R, Rudnick A. Isolation of Zika virus from Aedes aegypti mosquitoes in Malaysia. Am J Trop Med Hyg 1969;18:411-415 Web of Science | Medline 44 Grard G, Caron M, Mombo IM, et al. Zika virus in Gabon (Central Africa) — 2007: a new threat from Aedes albopictus? PLoS Negl Trop Dis 2014;8:e2681-e2681 CrossRef | Medline 45 Ledermann JP, Guillaumot L, Yug L, et al. Aedes hensilli as a potential vector of Chikungunya and Zika viruses. PLoS Negl Trop Dis 2014;8:e3188-e3188 CrossRef | Medline 46 Musso D, Nilles EJ, Cao-Lormeau VM. Rapid spread of emerging Zika virus in the Pacific area. Clin Microbiol Infect 2014;20:O595-6 CrossRef | Web of Science | Medline 47 Chouin-Carneiro T, Vega-Rua A, Vazeille M, et al. Differential susceptibilities of Aedes aegypti and Aedes albopictus from the Americas to Zika virus. PLoS Negl Trop Dis2016;10:e0004543-e0004543 CrossRef 48 Gubler DJ. The global emergence/resurgence of arboviral diseases as public health problems. Arch Med Res 2002;33:330-342 CrossRef | Web of Science | Medline 49 Monaghan AJ, Morin CW, Steinhoff DF, et al. On the seasonal occurrence and abundance of the Zika virus vector mosquito Aedes aegypti in the contiguous United States. PLoS Curr2016 March 16. Edition 1 (http://currents.plos.org/outbreaks/article/on-the-seasonal-occurrence-and-abundance-of-the-zika-virus-vector-mosquito-aedes-aegypti-in-the-contiguous-united-states/). 50 Effler PV, Pang L, Kitsutani P, et al. Dengue fever, Hawaii, 2001-2002. Emerg Infect Dis2005;11:742-749 CrossRef | Web of Science | Medline 51 Notes from the field: outbreak of locally acquired cases of dengue fever — Hawaii, 2015.MMWR Morb Mortal Wkly Rep 2016;65:34-35 CrossRef | Web of Science | Medline 52 Calvet G, Aguiar RS, Melo AS, et al. Detection and sequencing of Zika virus from amniotic fluid of fetuses with microcephaly in Brazil: a case study. Lancet Infect Dis2016 February 17 (Epub ahead of print) Medline 53 Oliveira Melo AS, Malinger G, Ximenes R, Szejnfeld PO, Alves Sampaio S, Bispo de Filippis AM. Zika virus intrauterine infection causes fetal brain abnormality and microcephaly: tip of the iceberg? Ultrasound Obstet Gynecol 2016;47:6-7 CrossRef | Web of Science | Medline 54 Zika virus infection among U.S. pregnant travelers — August 2015–February 2016. MMWR Morb Mortal Wkly Rep 2016;65:211-214 CrossRef | Web of Science | Medline 55 Notes from the field: evidence of Zika virus infection in brain and placental tissues from two congenitally infected newborns and two fetal losses — Brazil, 2015. MMWR Morb Mortal Wkly Rep 2016;65:159-160 CrossRef | Web of Science | Medline 56 Besnard M, Lastere S, Teissier A, Cao-Lormeau V, Musso D. Evidence of perinatal transmission of Zika virus, French Polynesia, December 2013 and February 2014. Euro Surveill 2014;19). CrossRef | Medline 57 Foy BD, Kobylinski KC, Chilson Foy JL, et al. Probable non-vector-borne transmission of Zika virus, Colorado, USA. Emerg Infect Dis 2011;17:880-882 CrossRef | Web of Science | Medline 58 Transmission of Zika virus through sexual contact with travelers to areas of ongoing transmission — continental United States, 2016. MMWR Morb Mortal Wkly Rep2016;65:215-216 CrossRef | Web of Science | Medline 59 Venturi G, Zammarchi L, Fortuna C, et al. An autochthonous case of Zika due to possible sexual transmission, Florence, Italy, 2014. Euro Surveill 2016;21). 60 Musso D, Roche C, Robin E, Nhan T, Teissier A, Cao-Lormeau VM. Potential sexual transmission of Zika virus. Emerg Infect Dis 2015;21:359-361 CrossRef | Web of Science | Medline 61 Atkinson B, Hearn P, Afrough B,et al. Detection of Zika virus in semen. Emerg Infect Dis 2016 May (Epub ahead of print). 62 Mansuy JM, Dutertre M, Mengelle C, et al. Zika virus: high infectious viral load in semen, a new sexually transmitted pathogen? Lancet Infect Dis2016 March 3 (Epub ahead of print) Medline 63 Marano G, Pupella S, Vaglio S, Liumbruno GM, Grazzini G. Zika virus and the never-ending story of emerging pathogens and transfusion medicine. Blood Transfus 2016;14:95-100 64 Musso D, Nhan T, Robin E, et al. Potential for Zika virus transmission through blood transfusion demonstrated during an outbreak in French Polynesia, November 2013 to February 2014. Euro Surveill 2014;19). CrossRef 65 Leung GH, Baird RW, Druce J, Anstey NM. Zika virus infection in Australia following a monkey bite in Indonesia. Southeast Asian J Trop Med Public Health 2015;46:460-464 Web of Science | Medline 66 Filipe AR, Martins CM, Rocha H. Laboratory infection with Zika virus after vaccination against yellow fever. Arch Gesamte Virusforsch 1973;43:315-319 CrossRef | Medline 67 Bearcroft WG. Zika virus infection experimentally induced in a human volunteer. Trans R Soc Trop Med Hyg 1956;50:442-448 CrossRef | Medline 68 Dupont-Rouzeyrol M, Biron A, O’Connor O, Huguon E, Descloux E. Infectious Zika viral particles in breastmilk. Lancet2016 March 1 (Epub ahead of print) Web of Science | Medline 69 Brasil P, Pereira JP Jr, Raja Gabaglia C, et al. Zika virus infection in pregnant women in Rio de Janeiro — preliminary report. N Engl J Med2016 March 4 (Epub ahead of print) Medline 70 Zammarchi L, Stella G, Mantella A, et al. Zika virus infections imported to Italy: clinical, immunological and virological findings, and public health implications. J Clin Virol2015;63:32-35 CrossRef | Web of Science | Medline 71 Karimi O, Goorhuis A, Schinkel J, et al. Thrombocytopenia and subcutaneous bleedings in a patient with Zika virus infection. Lancet 2016;387:939-940 CrossRef | Web of Science | Medline 72 Local transmission of Zika virus — Puerto Rico, November 23, 2015–January 28, 2016.MMWR Morb Mortal Wkly Rep 2016;65:154-158 CrossRef | Web of Science | Medline 73 Broutet N, Krauer F, Riesen M, et al. Zika virus as a cause of neurologic disorders. N Engl J Med2016 March 9 (Epub ahead of print) Medline 74 Rozé B, Najioullah F, Fergé JL, et al. Zika virus detection in urine from patients with Guillain-Barré syndrome on Martinique, January 2016. Euro Surveill 2016;21). CrossRef | Medline 75 Cao-Lormeau VM, Blake A, Mons S, et al. Guillain-Barré Syndrome outbreak associated with Zika virus infection in French Polynesia: a case-control study. Lancet2016 February 29 (Epub ahead of print) Medline 76 Carteaux G, Maquart M, Bedet A, et al. Zika virus associated with meningoencephalitis. N Engl J Med2016 March 9 (Epub ahead of print) Web of Science | Medline 77 Mécharles S, Herrmann C, Poullain P, et al. Acute myelitis due to Zika virus infection.Lancet2016 March 3 (Epub ahead of print) Medline 78 Webster WS. Teratogen update: congenital rubella. Teratology 1998;58:13-23 CrossRef | Medline 79 Ahlfors K, Ivarsson SA, Harris S. Report on a long-term study of maternal and congenital cytomegalovirus infection in Sweden: review of prospective studies available in the literature. Scand J Infect Dis 1999;31:443-457 CrossRef | Web of Science | Medline 80 Miller E, Cradock-Watson JE, Pollock TM. Consequences of confirmed maternal rubella at successive stages of pregnancy. Lancet 1982;2:781-784 CrossRef | Web of Science | Medline 81 Peckham CS. Clinical and laboratory study of children exposed in utero to maternal rubella.Arch Dis Child 1972;47:571-577 CrossRef | Web of Science | Medline 82 Rorke LB. Nervous system lesions in the congenital rubella syndrome. Arch Otolaryngol1973;98:249-251 CrossRef | Web of Science | Medline 83 Weller TH, Hanshaw JB, Scott DE. Virologic and clinical observations on cytomegalic inclusion disease. N Engl J Med 1962;266:1233-1244 Full Text | Web of Science | Medline 84 Pass RF, Fowler KB, Boppana SB, Britt WJ, Stagno S. Congenital cytomegalovirus infection following first trimester maternal infection: symptoms at birth and outcome. J Clin Virol 2006;35:216-220 CrossRef | Web of Science | Medline 85 Foulon I, Naessens A, Faron G, Foulon W, Jansen AC, Gordts F. Hearing thresholds in children with a congenital CMV infection: a prospective study. Int J Pediatr Otorhinolaryngol 2012;76:712-717 CrossRef | Web of Science | Medline 86 Alcantara D, O’Driscoll M. Congenital microcephaly. Am J Med Genet C Semin Med Genet2014;166C:124-139 CrossRef | Web of Science | Medline 87 Woods CG, Parker A. Investigating microcephaly. Arch Dis Child 2013;98:707-713 CrossRef | Web of Science | Medline 88 Update: interim guidelines for health care providers caring for infants and children with possible Zika virus infection — United States, February 2016. MMWR Morb Mortal Wkly Rep 2016;65:182-187 CrossRef | Web of Science | Medline 89 National Birth Defects Prevention Network. Major birth defects data from population-based birth defects surveillance programs in the United States, 2006-2010. August 2013 (http://www.nbdpn.org/docs/DataDirectory2013_NBDPN_AR.pdf). 90 Moore CA, Weaver DD, Bull MJ. Fetal brain disruption sequence. J Pediatr 1990;116:383-386 CrossRef | Web of Science | Medline 91 Rasmussen SA, Frias JL. Fetal brain disruption sequence: a brief case report. Dysmorph Clin Genet 1990;4:53-56 92 Corona-Rivera JR, Corona-Rivera E, Romero-Velarde E, Hernández-Rocha J, Bobadilla-Morales L, Corona-Rivera A. Report and review of the fetal brain disruption sequence. Eur J Pediatr 2001;160:664-667 CrossRef | Web of Science | Medline 93 Gabis L, Gelman-Kohan Z, Mogilner M. Microcephaly due to fetal brain disruption sequence: case report. J Perinat Med 1997;25:213-215 CrossRef | Web of Science | Medline 94 Mlakar J, Korva M, Tul N, et al. Zika virus associated with microcephaly. N Engl J Med2016;374:951-958 Free Full Text | Web of Science | Medline 95 Driggers RW, Ho C-Y, Korhonen EM, et al. Zika virus infection with prolonged maternal viremia and fetal brain abnormalities. N Engl J Med. DOI: 10.1056/NEJMoa1601824 Free Full Text 96 Increase in reported prevalence of microcephaly in infants born to women living in areas with confirmed Zika virus transmission during the first trimester of pregnancy — Brazil, 2015. MMWR Morb Mortal Wkly Rep 2016;65:242-247 CrossRef | Medline 97 Reefhuis J, Gilboa SM, Johansson MA, et al. Projecting month of birth for at-risk infants after Zika virus disease outbreaks. Emerg Infect Dis 2016. (in press). 98 Ventura CV, Maia M, Bravo-Filho V, Góis AL, Belfort R Jr. Zika virus in Brazil and macular atrophy in a child with microcephaly. Lancet 2016;387:228-228 CrossRef | Web of Science | Medline 99 Ventura CV, Maia M, Ventura BV, et al. Ophthalmological findings in infants with microcephaly and presumable intra-uterus Zika virus infection. Arq Bras Oftalmol2016;79:1-3 CrossRef | Medline 100 de Paula Freitas B, de Oliveira Dias JR, Prazeres J, et al. Ocular findings in infants with microcephaly associated with presumed Zika virus congenital infection in Salvador, Brazil.JAMA Ophthalmol2016 February 9 (Epub ahead of print) 101 Lanciotti RS, Kosoy OL, Laven JJ, et al. Genetic and serologic properties of Zika virus associated with an epidemic, Yap State, Micronesia, 2007. Emerg Infect Dis 2008;14:1232-1239 CrossRef | Web of Science | Medline 102 Busch MP, Kleinman SH, Tobler LH, et al. Virus and antibody dynamics in acute West Nile virus infection. J Infect Dis 2008;198:984-993 CrossRef | Web of Science | Medline 103 Update: interim guidelines for health care providers caring for pregnant women and women of reproductive age with possible Zika virus exposure — United States, 2016. MMWR Morb Mortal Wkly Rep 2016;65:122-127 CrossRef | Web of Science | Medline 104 Roehrig JT, Hombach J, Barrett AD. Guidelines for plaque-reduction neutralization testing of human antibodies to dengue viruses. Viral Immunol 2008;21:123-132 CrossRef | Web of Science | Medline 105 Morens DM, Burke DS, Halstead SB. The wages of original antigenic sin. Emerg Infect Dis2010;16:1023-1024 CrossRef | Web of Science | Medline 106 Johnson BW, Kosoy O, Martin DA, et al. West Nile virus infection and serologic response among persons previously vaccinated against yellow fever and Japanese encephalitis viruses. Vector Borne Zoonotic Dis 2005;5:137-145 CrossRef | Web of Science | Medline 107 Mohammed H, Tomashek KM, Stramer SL, Hunsperger E. Prevalence of anti-dengue immunoglobulin G antibodies among American Red Cross blood donors in Puerto Rico, 2006. Transfusion 2012;52:1652-1656 CrossRef | Web of Science | Medline 108 Gourinat AC, O’Connor O, Calvez E, Goarant C, Dupont-Rouzeyrol M. Detection of Zika virus in urine. Emerg Infect Dis 2015;21:84-86 CrossRef | Web of Science | Medline 109 Kutsuna S, Kato Y, Takasaki T, et al. Two cases of Zika fever imported from French Polynesia to Japan, December 2013 to January 2014. Euro Surveill 2014;19). CrossRef | Medline 110 Korhonen EM, Huhtamo E, Smura T, Kallio-Kokko H, Raassina M, Vapalahti O. Zika virus infection in a traveller returning from the Maldives, June 2015. Euro Surveill 2016;21). CrossRef | Medline 111 Musso D, Roche C, Nhan TX, Robin E, Teissier A, Cao-Lormeau VM. Detection of Zika virus in saliva. J Clin Virol 2015;68:53-55 CrossRef | Web of Science | Medline 112 den Hollander NS, Wessels MW, Los FJ, Ursem NT, Niermeijer MF, Wladimiroff JW. Congenital microcephaly detected by prenatal ultrasound: genetic aspects and clinical significance. Ultrasound Obstet Gynecol 2000;15:282-287 CrossRef | Web of Science | Medline 113 Bromley B, Benacerraf BR. Difficulties in the prenatal diagnosis of microcephaly. J Ultrasound Med 1995;14:303-306 Web of Science | Medline 114 Reddy UM, Abuhamad AZ, Levine D, Saade GR. Fetal imaging: executive summary of a Joint Eunice Kennedy Shriver National Institute of Child Health and Human Development, Society for Maternal-Fetal Medicine, American Institute of Ultrasound in Medicine, American College of Obstetricians and Gynecologists, American College of Radiology, Society for Pediatric Radiology, and Society of Radiologists in Ultrasound Fetal Imaging Workshop. Am J Obstet Gynecol 2014;210:387-397 CrossRef | Web of Science | Medline 115 Leibovitz Z, Daniel-Spiegel E, Malinger G, et al. Microcephaly at birth — the accuracy of three references for fetal head circumference: how can we improve prediction? Ultrasound Obstet Gynecol2015 Medline 116 Sarno M, Sacramento GA, Khouri R, et al. Zika virus infection and stillbirths: a case of hydrops fetalis, hydranencephaly and fetal demise. PLoS Negl Trop Dis 2016;10:e0004517-e0004517 CrossRef 117 Faye O, Freire CC, Iamarino A, et al. Molecular evolution of Zika virus during its emergence in the 20(th) century. PLoS Negl Trop Dis 2014;8:e2636-e2636 CrossRef | Medline 118 Lanciott RS, Lambert AJ, Holodniv M, Saavedra S, del Carmen Castillo Signor L. Phylogeny of Zika virus in Western Hemisphere. Emerg Infect Dis 2016 (in press). 119 Haddow AD, Schuh AJ, Yasuda CY, et al. Genetic characterization of Zika virus strains: geographic expansion of the Asian lineage. PLoS Negl Trop Dis 2012;6:e1477-e1477 CrossRef | Medline 120 Banks SD, Murray N, Wilder-Smith A, Logan JG. Insecticide-treated clothes for the control of vector-borne diseases: a review on effectiveness and safety. Med Vet Entomol2014;28:Suppl 1:14-25 CrossRef | Web of Science | Medline 121 Lenhart A, Orelus N, Maskill R, Alexander N, Streit T, McCall PJ. Insecticide-treated bednets to control dengue vectors: preliminary evidence from a controlled trial in Haiti. Trop Med Int Health 2008;13:56-67 CrossRef | Web of Science | Medline 122 Manrique-Saide P, Che-Mendoza A, Barrera-Perez M, et al. Use of insecticide-treated house screens to reduce infestations of dengue virus vectors, Mexico. Emerg Infect Dis2015;21:308-311 CrossRef | Web of Science | Medline 123 Che-Mendoza A, Guillermo-May G, Herrera-Bojórquez J, et al. Long-lasting insecticide-treated house screens and targeted treatment of productive breeding-sites for dengue vector control in Acapulco, Mexico. Trans R Soc Trop Med Hyg 2015;109:106-115 CrossRef | Web of Science | Medline 124 Brunkard JM, Robles López JL, Ramirez J, et al. Dengue fever seroprevalence and risk factors, Texas-Mexico border, 2004. Emerg Infect Dis 2007;13:1477-1483 CrossRef | Web of Science | Medline 125 Reiter P, Lathrop S, Bunning M, et al. Texas lifestyle limits transmission of dengue virus.Emerg Infect Dis 2003;9:86-89 CrossRef | Web of Science | Medline 126 Heintze C, Velasco Garrido M, Kroeger A. What do community-based dengue control programmes achieve? A systematic review of published evaluations. Trans R Soc Trop Med Hyg 2007;101:317-325 CrossRef | Web of Science | Medline 127 Barrera R, Amador M, Diaz A, Smith J, Munoz-Jordan JL, Rosario Y. Unusual productivity of Aedes aegypti in septic tanks and its implications for dengue control. Med Vet Entomol2008;22:62-69 CrossRef | Web of Science | Medline 128 Esu E, Lenhart A, Smith L, Horstick O. Effectiveness of peridomestic space spraying with insecticide on dengue transmission; systematic review. Trop Med Int Health 2010;15:619-631 Web of Science | Medline 129 Vazquez-Prokopec GM, Kitron U, Montgomery B, Horne P, Ritchie SA. Quantifying the spatial dimension of dengue virus epidemic spread within a tropical urban environment.PLoS Negl Trop Dis 2010;4:e920-e920 CrossRef | Medline 130 Paredes-Esquivel C, Lenhart A, Del Río R, et al. The impact of indoor residual spraying of deltamethrin on dengue vector populations in the Peruvian Amazon. Acta Trop2016;154:139-144 CrossRef | Web of Science | Medline 131 Adalja AA, Sell TK, Bouri N, Franco C. Lessons learned during dengue outbreaks in the United States, 2001-2011. Emerg Infect Dis 2012;18:608-614 CrossRef | Web of Science | Medline 132 Musso D, Cao-Lormeau VM, Gubler DJ. Zika virus: following the path of dengue and chikungunya? Lancet 2015;386:243-244 CrossRef | Web of Science | Medline 133 Bhatt S, Gething PW, Brady OJ, et al. The global distribution and burden of dengue. Nature2013;496:504-507 CrossRef | Web of Science | Medline 134 Weaver SC, Lecuit M. Chikungunya virus and the global spread of a mosquito-borne disease. N Engl J Med 2015;372:1231-1239 Full Text | Web of Science | Medline 135 Leparc-Goffart I, Nougairede A, Cassadou S, Prat C, de Lamballerie X. Chikungunya in the Americas. Lancet 2014;383:514-514 CrossRef | Web of Science | Medline 136 Wilder-Smith A, Gubler DJ. Geographic expansion of dengue: the impact of international travel. Med Clin North Am 2008;92:1377-1390 CrossRef | Web of Science | Medline
  23. FUTURE OUTLOOK AND DIRECTIONSThe current incidence of Zika virus infection in the Americas is difficult to gauge because the symptoms are nonspecific and generally mild, laboratory diagnosis is not uniformly available, and flavivirus antibody cross-reactivity complicates serologic assessment in areas in which dengue is endemic. Nevertheless, given the historically high incidence of dengue in the region and the recent experience with the chikungunya virus in the Americas, millions of Zika virus infections should be expected as the virus continues to spread.132-135 If Brazil serves as a bellwether for the rest of Latin America and the Caribbean, substantial numbers of infants with microcephaly and other adverse pregnancy outcomes could be identified in the upcoming months. The potential burden of illness from Guillain–Barré syndrome is hard to assess, given the difficulties with serologic diagnosis in areas where dengue is endemic and the paucity of published data on current incidence. The underlying reasons for the emergence of Zika virus in the past decade are unknown. Recent global increases in the incidence and spread of dengue, chikungunya, and now Zika virus — all with A. aegypti as the primary vector — suggest common underlying mechanisms for their emergence, such as globalization and urbanization.132,136 Other possible explanations include viral mutations affecting transmission or virulence and viral introduction to previously unexposed populations leading to epidemic spread. Further research will be required to determine whether the recently observed associations with adverse birth outcomes and Guillain–Barré syndrome simply reflect an increased incidence of infection or whether they result from a change in viral virulence. In areas of Africa and Asia where Zika virus is endemic, the incidence of infection, whether outbreaks will occur, and the reason for the previous lack of recorded cases of adverse pregnancy outcomes or Guillain–Barré syndrome are unknown. It is possible that many exposures occur in children, in whom Guillain–Barré syndrome may be less likely to develop and who would later be immune to infections during pregnancy. The long-term outlook with regard to the current Zika virus outbreak in the Americas is uncertain. Herd immunity sufficient to slow further transmission will undoubtedly occur, although this will not obviate the need for immediate and long-term prevention and control strategies. Whether and where the virus becomes endemic and whether an enzootic transmission cycle will develop somewhere in the Americas are matters of conjecture, but they are of considerable importance for the long-term development and sustainability of countermeasures, such as a Zika virus vaccine. What is clear is the need to rapidly and systematically address identified research gaps. These include a complete understanding of the frequency and full spectrum of clinical outcomes resulting from fetal Zika virus infection and of the environmental factors that influence emergence, as well as the development of discriminating diagnostic tools for flaviviruses, animal models for fetal developmental effects due to viral infection, new vector control products and strategies, effective therapeutics, and vaccines to protect humans against the disease.
  24. TREATMENT, PREVENTION, AND CONTROLAs with the other mosquito-borne flaviviruses, treatment for uncomplicated Zika virus infection focuses on symptoms. No Zika virus vaccine exists; thus, prevention and control measures center on avoiding mosquito bites, reducing sexual transmission, and controlling the mosquito vector. Potentially effective methods of prevention that are focused on reducing infections among pregnant women include avoiding unnecessary travel to areas of ongoing Zika virus transmission, avoiding unprotected sexual contact with partners who are at risk for Zika virus infection,103 and using mosquito repellent, permethrin treatment for clothing,120 bed nets,121 window screens,122,123 and air conditioning.124,125 The most effective A. aegypti vector control relies on an integrated approach that involves elimination of A. aegypti mosquito breeding sites, application of larvicides, and application of insecticides to kill adult mosquitoes. However, each of these approaches has substantial limitations. Communities are often mobilized to reduce A. aegypti breeding sites, but this strategy often fails, in part because of inconsistent participation among households and the presence of cryptic breeding sites in modern urban settings.126,127 Dengue control programs make extensive use of peridomestic insecticide spraying during outbreaks, but little evidence supports its efficacy as a single control intervention.128 The application of larvicides129 and indoor residual spraying129,130 have been effective in some settings. Given these limitations, an integrated prevention and vector-control approach combined with timely detection of illness, communication of up-to-date and correct information, and development of a rapid response that involves the community are recommended.131

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.