Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. To the Editor: Zika virus (ZIKV) is a mosquito-borne flavivirus related to yellow fever virus, dengue virus (DENV), and West Nile virus (WNV). It is a single-stranded positive RNA virus (10,794-nt genome) that is closely related to the Spondweni virus and is transmitted by many Aedes spp. mosquitoes, including Ae. africanus, Ae. luteocephalus, Ae. hensilli, andAe. aegypti. The virus was identified in rhesus monkeys during sylvatic yellow fever surveillance in the Zika Forest in Uganda in 1947 and was reported in humans in 1952 (1). In 2007, an outbreak of ZIKV was reported in Yap Island, Federated States of Micronesia (2). ZIKV also caused a major epidemic in the French Polynesia in 2013–2014 (3), and New Caledonia reported imported cases from French Polynesia in 2013 and reported an outbreak in 2014 (4). A new challenge has arisen in Brazil with the emergence of ZIKV and co-circulation with others arboviruses (i.e., DENV and chikungunya virus [CHIKV]). We report ZIKV infection in Brazil associated with a recent ongoing outbreak in Camaçari, Bahia, Brazil, of an illness characterized by maculopapular rash, fever, myalgias/arthralgia, and conjunctivitis. On March 26, 2015, serum samples were obtained from 24 patients (Table) at Santa Helena Hospital in Camaçari who were given a presumptive diagnosis of an acute viral illness by emergency department physicians. These patients were given treatment for a dengue-like illness, and blood samples were obtained for complete blood counts and serologic testing by using an ELISA specific for IgG and IgM against DENV. Serum samples were analyzed at the Federal University of Bahia by reverse transcription PCR (RT-PCR) to detect DENV, CHIKV, WNV, Mayaro virus, and ZIKV. In brief, serum samples were subjected to RNA extraction by using the QIAamp Viral RNA Mini Kit (QIAGEN, Hilden, Germany). RNA was reverse transcribed by using the SuperScript II Reverse Transcription Kit (Invitrogen, Carlsbad, CA, USA) and subjected to PCRs specific for DENV (5) CHIKV (6), WNV (7) and Mayaro virus (8). A positive RT-PCR for a partial region of the envelope gene with primers ZIKVENF and ZIKVENVR (positions 1538–1558 and 1902–1883, respectively) (9) was considered indicative of ZIKV infection. PCR products (362 bp) were sequenced at the ACTGene Analises Moleculares, Alvorada, Rio Grande do Sul (Porto Allegre, Brazil), and sequences were deposited in GenBank under accession nos. KR816333–KR816336. All patients were negative by RT-PCR for DENV, Mayaro virus, and WNV. Samples from 7 (29.2%) patients were positive by RT-PCR for ZIKV (369-bp fragment) and from 3 (12.5%) patients for CHIKV (305-bp fragment). There was no simultaneous detection of ZIKV and CHIKV. Most (85.7%) patients positive for ZIKV were women; they had a median age of 28 years and no history of international travel. Patients positive for ZIKV sought medical care after a 4-day (range 1–5 days) history of rash, myalgias, arthralgias, or fever. Three patients had IgG against DENV, which is consistent with a previous DENV infection, and none of the 7 ZIKV-positive patients had a positive response for DENV. Mean laboratory findings for patients with acute ZIKV infection were a leukocyte count of 3,750 cells/mm3 (range 2,790 cells/mm3–6,150 cells/mm3) and a platelet count of 180,000 platelets/mm3 (range 151,000 platelets/mm3–274,000 platelets/mm3). The mean C-reactive protein level was 16.3 mg/L (range 0.9 mg/L–19.7 mg/L). Sign and symptom duration was 1–5 days, and most patients had a maculopapular rash, myalgias, fever, and headache. Arthralgia was seen less frequently. ZIKV infections were assessed by sequencing partial ZIKV envelope gene regions of isolates. Phylogenetic analysis rooted with Spondwei virus showed that ZIKV sequences obtained belonged to the Asian lineage and showed 99% identity with a sequence from a ZIKV isolate from French Polynesia (KJ776791) (10). We report ZIKV infection in Brazil in association with an ongoing outbreak of an acute maculoexantematic illness. Although the patient population samples were not randomly selected, 42% (10/24) of the patients were positive for ZIKV (n = 7) or CHIKV (n = 3) and had maculopapular rash, fever, myalgias and headache. After detection of ZIKV in Bahia, many cases have been identified in other states (http://www.promedmail.org, archive no. 20152015602.343.1158). Cases of infection with DENV, CHIKV, and ZIKV in Brazil and elsewhere will make diagnosis based on clinical and epidemiologic grounds unreliable. These issues show the need for laboratory confirmation of these arboviral infections. More studies are needed to address the effects of these concurrent arboviruses infections in Brazil. Gubio S. Campos, Antonio C. Bandeira, and Silvia I. Sardi Author affiliations: Federal University of Bahia, Salvador, Bahia, Brazil (G.S. Campos, S.I. Sardi); Hospital Aliança, Salvador (A.C. Bandeira) AcknowledgmentThis study was supported by Fundação de Amparo a Pesquisa do Estado da Bahia. ReferencesDick GW, Kitchen SF, Haddow AJ. Zika virus. I. Isolations and serological specificity. Trans R Soc Trop Med Hyg.1952;46:509–20 . DOIPubMedDuffy MR, Chen T-H, Hancock WT, Powers AM. Zika virus outbreak on Yap Island, Federated States of Micronesia. N Engl J Med. 2009;360:2536–43. DOIPubMedCao-Lormeau VM, Roche C, Teissier A, Robin E, Berry AL, Mallet HP, Zika virus, French Polynesia, South Pacific, 2013.Emerg Infect Dis. 2014;20:1085–6. DOIPubMedDupont-Rouzeyrol M, O’Connor O, Calvez E, Daures M, John M, Grangeon JP, Co-infection with zika and dengue viruses in 2 patients, New Caledonia, 2014. Emerg Infect Dis. 2015;21:381–2 . DOIPubMedLanciotti RS, Calisher CH, Gubler DJ, Chang G, Vorndam AV. Rapid detection and typing of dengue viruses from clinical samples by using reverse transcriptase polymerase chain reaction. J Clin Microbiol. 1992;30:545–51.PubMedEdwards CJ, Welch SR, Chamberlain J, Hewson R, Tolley H, Cane PA, Molecular diagnosis and analysis of chikungunya virus. J Clin Virol. 2007;39:271–5. DOIPubMedChowdhury P, Kham SA, Dutta P, Topno R, Mahanta J. Characterization of West Nile virus (WNV) isolates from Assam, India: insights into the circulating WVN in northeastern India. Comp Immunol Microbiol Infect Dis.2014;37:39–46. DOIPubMedMourão MP, Souza Bastos M, Figuereido RP, Gimaque JB, Galusso Edos S, Kramer VM, Mayaro fever in the city of Manaus, Brazil, 2007–2008. Vector Borne Zoonotic Dis. 2012;12:42–5 .PubMedFaye O, Faye O, Dupressoir A, Weidmann M, Ndiaye M, Sall AA. One-step RT-PCR for detection of Zika virus. J Clin Virol. 2008;43:96–101. DOIPubMedBaronti C, Piorkowski G, Charrel RN, Boubis L, Leparc-Goffart I, de Lamballierie X. Complete sequence of Zika virus from a French Polynesia outbreak in 2013. Genome Announc. 2014;2:e00500–14.TableTable. Characteristics of 24 patients with positive and negative results for infection with Zika virus, Brazil, 2015 Suggested citation for this article: Campos GS, Bandeira AC, Sardi SI. Zika virus outbreak, Bahia, Brazil [letter]. Emerg Infect Dis. 2015 Oct [date cited]. http://dx.doi.org/10.3201/eid2110.150847 DOI: 10.3201/eid2110.150847
  2. Volume 21, Number 10—October 2015LetterZika Virus Outbreak, Bahia, Brazilhttp://wwwnc.cdc.gov/eid/article/21/10/15-0847_article
  3. Sequence map update https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
  4. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU940224.1|Zika virus isolate Bahia09, partial genome1843518435100%0.0100%KU940224.1Select seq gb|KU940228.1|Zika virus isolate Bahia07, partial genome1842918429100%0.099%KU940228.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1830918309100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1830318303100%0.099%KJ776791.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1829418294100%0.099%KU729218.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1829418294100%0.099%KU321639.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1828518285100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1828518285100%0.099%KU365779.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1827318273100%0.099%KU926309.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1827318273100%0.099%KU365780.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1826718267100%0.099%KU647676.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1826718267100%0.099%KU365777.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1826418264100%0.099%KU501217.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome182601826099%0.099%KU497555.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1825818258100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1825818258100%0.099%KU527068.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1825818258100%0.099%KU501216.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1825418254100%0.099%KU820897.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1825418254100%0.099%KU501215.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1825418254100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1825418254100%0.099%KU312312.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1824918249100%0.099%KU922960.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1824518245100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1824518245100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1824518245100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1824418244100%0.099%KU853012.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1824018240100%0.099%KU870645.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1822718227100%0.099%KU820898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1822218222100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1821818218100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1821818218100%0.099%KU761564.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1820018200100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1820018200100%0.099%KU820899.2Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1809218092100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1806018060100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1796117961100%0.099%KU681081.3Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds176901769099%0.099%KF993678.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1765917659100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds176581765899%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1751917519100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1735317353100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds163341633499%0.095%HQ234499.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1323613236100%0.089%KU720415.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds132301323099%0.089%HQ234498.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1322713227100%0.089%KF383119.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1322513225100%0.089%KF383115.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1321413214100%0.089%LC002520.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1321213212100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1321213212100%0.089%KF268948.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1320513205100%0.089%KF268950.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1320013200100%0.089%KU955595.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1319813198100%0.089%KU955594.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1319113191100%0.089%KU955592.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1318913189100%0.089%DQ859059.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1317313173100%0.089%KU955591.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1317113171100%0.089%KF383116.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1316913169100%0.089%AY632535.2Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds131461314699%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1310013100100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds130751307599%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1290012968100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds128251282597%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence107961079697%0.084%KF383120.1Select seq gb|KU940227.1|Zika virus isolate Bahia08, partial genome50791452387%0.095%KU940227.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds4895489526%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds4868486826%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4652465225%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4643464325%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3433343318%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3205320517%0.099%KU740199.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds2870415095%0.071%DQ859064.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2684268414%0.099%KJ634273.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2012201211%0.099%KU179098.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds1977197711%0.099%KU686218.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds174317439%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds173917399%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds173717379%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds173617369%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds173617369%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds173617369%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds173417349%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds159315938%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds141514157%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds137313737%0.099%KM851039.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds134613467%0.098%KM851038.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds134213427%0.099%KU556802.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds1315131510%0.088%AF013415.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds123612366%0.099%KT200609.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds123412346%0.099%KU232300.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds122512256%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds122312236%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds121612166%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds121312136%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds120912096%0.099%KU232298.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds120712076%0.099%KU232293.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232296.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds120212026%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds119111916%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds118711876%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds118411846%0.099%KU232299.1
  5. LOCUS KU940224 10525 bp RNA linear VRL 23-MAR-2016 DEFINITION Zika virus isolate Bahia09, partial genome. ACCESSION KU940224 VERSION KU940224.1 GI:1007623989 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10525) AUTHORS Sardi,S.I., Somasekar,S., Bandeira,A.C., Naccache,S.N., Campos,G.S. and Chiu,C.Y. TITLE Metagenomic Next-Generation Sequencing for Detection of Zika and Chikungunya Virus Co-Infections in Bahia, Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10525) AUTHORS Sardi,S.I., Somasekar,S., Bandeira,A.C., Naccache,S.N., Campos,G.S. and Chiu,C.Y. TITLE Direct Submission JOURNAL Submitted (18-MAR-2016) Laboratory Medicine, University of California, San Francisco, 185 Berry Street, Box #0134, San Francisco, CA 94107, USA COMMENT ##Assembly-Data-START## Assembly Method :: SURPI+ v. v1.0; Geneious v. v8.0 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10525 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Bahia09" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="01-Aug-2015" CDS <1..10226 /codon_start=3 /product="polyprotein" /protein_id="AMQ76459.1" /db_xref="GI:1007623990" /translation="LKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIK PSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKKRRGADTSVGIVGLLLT TAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMSYECP MLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTW LESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIR CIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYC YEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAK FACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRA EATLGGFGSLGLDCEPRTGLDFSDLYYLXMNNKHWLVHKEWFHDIPLPWHAGADTGTP HWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCR LKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQ TLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIG KAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQI LIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGCSVDFSKKETRCGTGVF VYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSRMENIMWRSVEGELNAI LEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSYFVRAAKTNNSFVVD GDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLECDPAVIGTAVKGKEAV HSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGIEESDLIIPKSLAGPLS HHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTRGPSLRSTTASGRVIEE WCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTAGSTDHMDHFSLGVLVI LLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLAILMGATFAEMNTGGDV AHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQTAISALEGDLMVLINGF ALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGLATCGGFMLLSLKGKGS VKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSEVLTAVGLICALAGGFA KADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDE SGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWYVYVKTGKRSGALWDVP APKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGSALRSGEGRLD PYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARNIQTLPGIFKTKGGDIG AVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGRREEETPVECFEPS MLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRVVAAEMEEALRGLP VRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLYIMDEAHFTDPSSIAAR GYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEVPERAWSSGFDWVTDHS GKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDFVVTTDISEM GANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQRRGRIGRNPNKPGDEYL YGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRK TFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSVPAEVWTRHGEKR VLKPRWMDARVCSDHAALKSFKEFAAGKRGAALGVMEALGTLPGHMTERFQEAIDNLA VLMRAETGSRPYKAAAAQMPETLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVT LGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSPQDNQMAIIIMVAVGLL GLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPASAWAIYAALTTFITPA VQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPLLMIGCYSQLTPLTLIV AIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIVVTDIDTMTIDPQVEKK MGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSPNKYWNSSTATSLCNIF RGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQMSALEFYSYKKSGITE VCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPHGKVIDLGCGRGGWSYYAA TIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFHMAAEPCDTLLCDIGES SSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMMETLERLQRRYGGGLVR VPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRPVKYEEDVNLGSGTRAV VSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHGSYEAPTQGSASSLVNG VVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPDPQEGTRQVMSMVSSWL WKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAVEAVNDPRFWALVDKER EHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHW MGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWDTRISRFDLENEALITN QMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQDQRGSGQVVTYALNTF TNLVVQLIRNMEAEEVLEMQDLWLLRRPEKVTNWLQSNGWDRLKRMAVSGDDCVVKPI DDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLKDGRSIVVPC RHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMANAICSSVPVD WVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKTPVTKWTDIPYLGKRED LWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLSTQVRYLGEEGSTPGVL" mat_peptide 3..329 /product="capsid" mat_peptide 330..599 /product="pro" mat_peptide 600..824 /product="membane protein" mat_peptide 825..2339 /product="envelope protein" mat_peptide 2340..3425 /product="NS1" mat_peptide 3426..4079 /product="NS2A" mat_peptide 4080..4511 /product="NS2B" mat_peptide 4512..6320 /product="NS3" mat_peptide 6321..6761 /product="NS4A" mat_peptide 6762..8267 /product="NS4B" mat_peptide 8268..10223 /product="NS5" 3'UTR 10227..10525 ORIGIN 1 tgctaaaacg cggagtagcc cgtgtgagcc cctttggggg cttgaagagg ctgccagccg 61 gacttctgct gggtcatggg cccatcagga tggtcttggc gattctagcc tttttgagat 121 tcacggcaat caagccatca ctgggtctca tcaatagatg gggttcagtg gggaaaaaag 181 aggctatgga aataataaag aagttcaaga aagatctggc tgccatgctg agaataatca 241 atgctaggaa ggagaagaag agacgaggcg cagatactag tgtcggaatt gttggcctcc 301 tgctgaccac agctatggca gcggaggtca ctagacgtgg gagtgcatac tatatgtact 361 tggacagaaa cgatgctggg gaggccatat cttttccaac cacattgggg atgaataagt 421 gttatataca gatcatggat cttggacaca tgtgtgatgc caccatgagc tatgaatgcc 481 ctatgctgga tgagggggtg gaaccagatg acgtcgattg ttggtgcaac acgacgtcaa 541 cttgggttgt gtacggaacc tgccatcaca aaaaaggtga agcacggaga tctagaagag 601 ctgtgacgct cccctcccat tccactagga agctgcaaac gcggtcgcaa acctggttgg 661 aatcaagaga atacacaaag cacttgatta gagtcgaaaa ttggatattc aggaaccctg 721 gcttcgcgtt agcagcagct gccatcgctt ggcttttggg aagctcaacg agccaaaaag 781 tcatatactt ggtcatgata ctgctgattg ccccggcata cagcatcagg tgcataggag 841 tcagcaatag ggactttgtg gaaggtatgt caggtgggac ttgggttgat gttgtcttgg 901 aacatggagg ttgtgtcacc gtaatggcac aggacaaacc gactgtcgac atagagctgg 961 ttacaacaac agtcagcaac atggcggagg taagatccta ctgctatgag gcatcaatat 1021 cagacatggc ttcggacagc cgctgcccaa cacaaggtga agcctacctt gacaagcaat 1081 cagacactca atatgtctgc aaaagaacgt tagtggacag aggctgggga aatggatgtg 1141 gactttttgg caaagggagc ctggtgacat gcgctaagtt tgcatgctcc aagaaaatga 1201 ccgggaagag catccagcca gagaatctgg agtaccggat aatgctgtca gttcatggct 1261 cccagcacag tgggatgatc gttaatgaca caggacatga aactgatgag aatagagcga 1321 aggttgagat aacgcccaat tcaccaagag ccgaagccac cctggggggt tttggaagcc 1381 taggacttga ttgtgaaccg aggacaggcc ttgacttttc agatttgtat tacttganna 1441 tgaataacaa gcactggttg gttcacaagg agtggttcca cgacattcca ttaccttggc 1501 acgctggggc agacaccgga actccacact ggaacaacaa agaagcactg gtagagttca 1561 aggacgcaca tgccaaaagg caaactgtcg tggttctagg gagtcaagaa ggagcagttc 1621 acacggccct tgctggagct ctagaggctg agatggatgg tgcaaaggga aggctgtcct 1681 ctggccactt gaaatgtcgc ctgaaaatgg ataaacttag attgaagggc gtgtcatact 1741 ccttgtgtac cgcagcgttc acattcacca agatcccggc tgaaacactg cacgggacag 1801 tcacagtgga ggtacagtac gcagggactg atggaccttg caaggttcca gctcagatgg 1861 cggtggacat gcaaactctg accccagttg ggaggttgat aaccgctaac cccgtaatca 1921 ctgaaagcac tgagaactct aagatgatgc tggaacttga tccaccattt ggggactcct 1981 acattgtcat aggagtcggg gagaagaaga tcacccacca ctggcacagg agtggcagca 2041 ccattggaaa agcatttgaa gccactgtga gaggtgccaa gagaatggca gtcttgggag 2101 acacagcctg ggactttgga tcagttggag gcgctctcaa ctcattgggc aagggcatcc 2161 atcaaatttt tggagcagct ttcaaatcat tgtttggagg aatgtcctgg ttctcacaaa 2221 ttctcattgg aacgttgctg atgtggttgg gtctgaacac aaagaatgga tctatttccc 2281 ttatgtgctt ggccttaggg ggagtgttga tcttcttatc cacagccgtc tctgctgatg 2341 tggggtgctc ggtggacttc tcaaagaagg agacgagatg cggtacaggg gtgttcgtct 2401 ataacgacgt tgaagcctgg agggacaggt acaagtacca tcctgactcc ccccgtagat 2461 tggcagcagc agtcaagcaa gcctgggaag atggtatctg cgggatctcc tctgtttcaa 2521 gaatggaaaa catcatgtgg agatcagtag aaggggagct caacgcaatc ctggaagaga 2581 atggagttca actgacggtc gttgtgggat ctgtaaaaaa ccccatgtgg agaggtccac 2641 agagattgcc cgtgcctgtg aacgagctgc cccacggctg gaaggcttgg gggaaatcgt 2701 acttcgtcag agcagcaaag acaaataaca gctttgtcgt ggatggtgac acactgaagg 2761 aatgcccact caaacataga gcatggaaca gctttcttgt ggaggatcat gggttcgggg 2821 tatttcacac tagtgtctgg ctcaaggtta gagaagatta ttcattagag tgtgatccag 2881 ccgttattgg aacagctgtt aagggaaagg aggctgtaca cagtgatcta ggctactgga 2941 ttgagagtga gaagaatgac acatggaggc tgaagagggc ccatctgatc gagatgaaaa 3001 catgtgaatg gccaaagtcc cacacattgt ggacagatgg aatagaagag agtgatctga 3061 tcatacccaa gtctttagct gggccactca gccatcacaa taccagagag ggctacagga 3121 cccaaatgaa agggccatgg cacagtgaag agcttgaaat tcggtttgag gaatgcccag 3181 gcactaaggt ccacgtggag gaaacatgtg gaacaagagg accatctctg agatcaacca 3241 ctgcaagcgg aagggtgatc gaggaatggt gctgcaggga gtgcacaatg cccccactgt 3301 cgttccgggc taaagatggc tgttggtatg gaatggagat aaggcccagg aaagaaccag 3361 aaagcaactt agtaaggtca atggtgactg caggatcaac tgatcacatg gatcacttct 3421 cccttggagt gcttgtgatt ctgctcatgg tgcaggaagg gctgaagaag agaatgacca 3481 caaagatcat cataagcaca tcaatggcag tgctggtagc tatgatcctg ggaggatttt 3541 caatgagtga cctggctaag cttgcaattt tgatgggtgc caccttcgcg gaaatgaaca 3601 ctggaggaga tgtagctcat ctggcgctga tagcggcatt caaagtcaga ccagcgttgc 3661 tggtatcttt catcttcaga gctaattgga caccccgtga aagcatgctg ctggccttgg 3721 cctcgtgtct tttgcaaact gcgatctccg ccttggaagg cgacctgatg gttctcatca 3781 atggttttgc tttggcctgg ttggcaatac gagcgatggt tgttccacgc actgataaca 3841 tcaccttggc aatcttggct gctctgacac cactggcccg gggcacactg cttgtggcgt 3901 ggagagcagg ccttgctact tgcggggggt ttatgctcct ctctctgaag ggaaaaggca 3961 gtgtgaagaa gaacttacca tttgtcatgg ccctgggact aaccgctgtg aggctggtcg 4021 accccatcaa cgtggtggga ctgctgttgc tcacaaggag tgggaagcgg agctggcccc 4081 ccagcgaagt actcacagct gttggcctga tatgcgcatt ggctggaggg ttcgccaagg 4141 cagatataga gatggctggg cccatggccg cggtcggtct gctaattgtc agttacgtgg 4201 tctcaggaaa gagtgtggac atgtacattg aaagagcagg tgacatcaca tgggaaaaag 4261 atgcggaagt cactggaaac agtccccggc tcgatgtggc gctagatgag agtggtgatt 4321 tctccctggt ggaggatgac ggtcccccca tgagagagat catactcaag gtggtcctga 4381 tgaccatctg tggcatgaac ccaatagcca taccctttgc agctggagcg tggtacgtat 4441 acgtgaagac tggaaaaagg agtggtgctc tatgggatgt gcctgctccc aaggaagtaa 4501 aaaaggggga gaccacagat ggagtgtaca gagtaatgac tcgtagactg ctaggttcaa 4561 cacaagttgg agtgggagtt atgcaagagg gggtctttca cactatgtgg cacgtcacaa 4621 aaggatccgc gctgagaagc ggtgaaggga gacttgatcc atactgggga gatgtcaagc 4681 aggatctggt gtcatactgt ggtccatgga agctagatgc cgcctgggac gggcacagcg 4741 aggtgcagct cttggccgtg ccccccggag agagagcgag gaacatccag actctgcccg 4801 gaatatttaa gacaaagggt ggggacattg gagcggttgc gctggattac ccagcaggaa 4861 cttcaggatc tccaatccta gacaagtgtg ggagagtgat aggactttat ggcaatgggg 4921 tcgtgatcaa aaatgggagt tatgttagtg ccatcaccca agggaggagg gaggaagaga 4981 ctcctgttga gtgcttcgag ccttcgatgc tgaagaagaa gcagctaact gtcttagact 5041 tgcatcctgg agctgggaaa accaggagag ttcttcctga aatagtccgt gaagccataa 5101 aaacaagact ccgtactgtg atcttagctc caaccagggt tgtcgctgct gaaatggagg 5161 aagcccttag agggcttcca gtgcgttata tgacaacagc agtcaatgtc acccactctg 5221 gaacagaaat cgtcgactta atgtgccatg ccaccttcac ttcacgtcta ctacagccaa 5281 tcagagtccc caattataat ctgtatatta tggatgaggc ccacttcaca gatccctcaa 5341 gtatagcagc aagaggatac atttcaacaa gggttgagat gggcgaggcg gctgccatct 5401 tcatgaccgc cacgccacca ggaacccgtg acgcatttcc ggactccaac tcaccaatta 5461 tggacaccga agtggaagtc ccagagagag cctggagctc aggctttgat tgggtgacgg 5521 atcattctgg aaaaacagtt tggtttgttc caagcgtgag gaacggcaat gagatcgcag 5581 cttgtctgac aaaggctgga aaacgggtca tacagctcag cagaaagact tttgagacag 5641 agttccagaa aacaaaacat caagagtggg actttgtcgt gacaactgac atttcagaga 5701 tgggcgccaa ctttaaagct gaccgtgtca tagattccag gagatgccta aagccggtca 5761 tacttgatgg cgagagagtc attctggctg gacccatgcc tgtcacacat gccagcgctg 5821 cccagaggag ggggcgcata ggcaggaatc ccaacaaacc tggagatgag tatctgtatg 5881 gaggtgggtg cgcagagact gacgaagacc atgcacactg gcttgaagca agaatgctcc 5941 ttgacaatat ttacctccaa gatggcctca tagcctcgct ctatcgacct gaggccgaca 6001 aagtagcagc cattgaggga gagttcaagc ttaggacgga gcaaaggaag acctttgtgg 6061 aactcatgaa aagaggagat cttcctgttt ggctggccta tcaggttgca tctgccggaa 6121 taacctacac agatagaaga tggtgctttg atggcacgac caacaacacc ataatggaag 6181 acagtgtgcc ggcagaggtg tggaccagac acggagagaa aagagtgctc aaaccgaggt 6241 ggatggatgc cagagtttgt tcagatcatg cggccctgaa gtcattcaag gagtttgccg 6301 ctgggaaaag aggagcggct cttggagtga tggaagccct gggaacactg ccaggacaca 6361 tgacagagag attccaggaa gccattgaca acctcgctgt gctcatgcgg gcagagactg 6421 gaagcaggcc ttacaaagcc gcggcggccc aaatgccgga gaccctagag accattatgc 6481 ttttggggtt gctaggaaca gtctcgctgg gaatcttttt cgtcttgatg aggaacaagg 6541 gcatagggaa gatgggcttt ggaatggtga ctcttggggc cagcgcatgg ctcatgtggc 6601 tctcggaaat tgagccagcc agaattgcat gtgtcctcat tgttgtgttc ctattgctgg 6661 tggtgctcat acctgagcca gaaaagcaaa gatctcccca ggacaaccaa atggcaatca 6721 tcatcatggt agcagtaggt cttctgggct tgattaccgc caatgaactc ggatggttgg 6781 agagaacaaa gagtgaccta agccatctaa tgggaaggag agaggagggg gcaaccatag 6841 gattctcaat ggacattgac ctgcggccag cctcagcttg ggccatctat gctgccttga 6901 caactttcat taccccagcc gtccaacatg cagtgaccac ttcatacaac aactactcct 6961 taatggcgat ggccacgcaa gctggagtgt tgtttggtat gggcaaaggg atgccattct 7021 acgcatggga ctttggagtc ccgctgctaa tgataggttg ctactcacaa ttaacacccc 7081 tgaccctaat agtggccatc attttgctcg tggcgcacta catgtacttg atcccagggc 7141 tgcaggcagc agctgcgcgt gctgcccaga agagaacggc agctggcatc atgaagaacc 7201 ctgttgtgga tggaatagtg gtgactgaca ttgacacaat gacaattgac ccccaagtgg 7261 agaaaaagat gggacaggtg ctactcatag cagtagccgt ctccagcgcc atactgtcgc 7321 ggaccgcctg ggggtggggg gaggctgggg ctctgatcac agccgcaact tccactttgt 7381 gggaaggctc tccgaacaag tactggaact cctctacagc cacttcactg tgtaacattt 7441 ttaggggaag ttacttggct ggagcttctc taatctacac agtaacaaga aacgctggct 7501 tggtcaagag acgtgggggt ggaacaggag agaccctggg agagaaatgg aaggcccgct 7561 tgaaccagat gtcggccctg gagttctact cctacaaaaa gtcaggcatc accgaggtgt 7621 gcagagaaga ggcccgccgc gccctcaagg acggtgtggc aacgggaggc catgctgtgt 7681 cccgaggaag tgcaaagctg agatggttgg tggagcgggg atacctgcag ccccatggaa 7741 aggtcattga tcttggatgt ggcagagggg gctggagtta ctacgccgcc accatccgca 7801 aagttcaaga agtgaaagga tacacaaaag gaggccctgg tcatgaagaa cccgtgttgg 7861 tgcaaagcta tgggtggaac atagtccgtc ttaagagtgg ggtggacgtc tttcatatgg 7921 cggctgagcc gtgtgacacg ttgctgtgtg acataggtga gtcatcatct agtcctgaag 7981 tggaagaagc acggacgctc agagttctct ccatggtggg ggattggctt gaaaaaagac 8041 caggagcctt ttgtataaaa gtgttgtgcc catacaccag cactatgatg gaaaccctgg 8101 agcgactgca gcgtaggtat gggggaggac tggtcagagt gccactctcc cgcaactcta 8161 cacatgagat gtactgggtc tctggagcga aaagcaacac cataaaaagt gtgtccacca 8221 cgagccagct cctcttgggg cgcatggacg ggcctaggag gccagtgaaa tatgaggagg 8281 atgtgaatct cggctctggc acgcgggctg tggtaagctg cgctgaagct cccaacatga 8341 agatcattgg taaccgcatt gaaaggatcc gcagtgagca cgcggaaacg tggttctttg 8401 acgagaacca cccatatagg acatgggctt accatggaag ctatgaggcc cccacacaag 8461 ggtcagcgtc ctctctagta aacggggttg tcaggctcct gtcaaaaccc tgggatgtgg 8521 tgactggagt cacaggaata gccatgaccg acaccacacc gtatggtcag caaagagttt 8581 tcaaggaaaa agtggacact agggtgccag acccccaaga aggcactcgt caggttatga 8641 gcatggtctc ttcctggttg tggaaagagc taggcaaaca caaacggcca cgagtctgta 8701 ccaaagaaga gttcatcaac aaggttcgta gcaatgcagc actaggggca atatttgaag 8761 aggaaaaaga gtggaagact gcagtggaag ctgtgaacga tccaaggttc tgggctctag 8821 tggacaagga aagagagcac cacctgagag gagagtgcca gagttgtgtg tacaacatga 8881 tgggaaaaag agaaaagaaa caaggggaat ttggaaaggc caagggcagc cgcgccatct 8941 ggtatatgtg gctaggggct agatttctag agttcgaagc ccttggattc ttgaacgagg 9001 atcactggat ggggagagag aactcaggag gtggtgttga agggctggga ttacaaagac 9061 tcggatatgt cctagaagag atgagtcgca taccaggagg aaggatgtat gcagatgaca 9121 ctgctggctg ggacacccgc atcagcaggt ttgatctgga gaatgaagct ctaatcacca 9181 accaaatgga gaaagggcac agggccttgg cattggccat aatcaagtac acataccaaa 9241 acaaagtggt aaaggtcctt agaccagctg aaaaagggaa aacagttatg gacattattt 9301 cgagacaaga ccaaaggggg agcggacaag ttgtcactta cgctcttaac acatttacca 9361 acctagtggt gcaactcatt cggaatatgg aggctgagga agttctcgag atgcaagact 9421 tgtggctgct gcggaggcca gagaaagtga ccaactggtt gcagagcaac ggatgggata 9481 ggctcaaacg aatggcagtc agtggagatg attgcgttgt gaagccaatt gatgataggt 9541 ttgcacatgc cctcaggttc ttgaatgata tgggaaaagt taggaaggac acacaagagt 9601 ggaaaccctc aactggatgg gacaactggg aagaagttcc gttttgctcc caccacttca 9661 acaagctcca tctcaaggac gggaggtcca ttgtggttcc ctgccgccac caagatgaac 9721 tgattggccg ggcccgcgtc tctccagggg cgggatggag catccgggag actgcttgcc 9781 tagcaaaatc atatgcgcaa atgtggcagc tcctttattt ccacagaagg gacctccgac 9841 tgatggccaa tgccatttgc tcatctgtgc cagttgactg ggttccaact gggagaacta 9901 cctggtcaat ccatggaaag ggagaatgga tgaccactga agacatgctt gtggtgtgga 9961 acagagtgtg gattgaggag aacgaccaca tggaagacaa gaccccagtt acgaaatgga 10021 cagacattcc ctatttggga aaaagggaag acttgtggtg tggatctctc atagggcaca 10081 gaccgcgcac cacctgggct gagaacatta aaaacacagt caacatggtg cgcaggatca 10141 taggtgatga agaaaagtac atggactacc tatccaccca agttcgctac ttgggtgaag 10201 aagggtctac acctggagtg ctgtaagcac cagtcttaat gttgtcaggc ctgctagtca 10261 gccacagctt ggggaaagct gtgcagcctg tgaccccccc aggagaagct gggaaaccaa 10321 gcctatagtc aggccgagaa cgccatggca cggaagaagc catgctgcct gtgagcccct 10381 cagaggacac tgagtcaaaa aaccccacgc gcttggaggc gcaggatggg aaaagaaggt 10441 ggcgaccttc cccacccttc aatctggggc ctgaactgga gatcagctgt ggatctccag 10501 aagagggact agtggttaga ggaga
  6. Sequence map update https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
  7. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds32323232100%0.099%KU729218.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome32273227100%0.099%KU707826.1Select seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome32273227100%0.099%KU509998.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds32273227100%0.099%KU365780.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds32273227100%0.099%KU365779.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds32273227100%0.099%KU365777.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome32273227100%0.099%KU321639.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome32233223100%0.099%KU926309.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds32183218100%0.099%KU501217.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds32183218100%0.099%KU501216.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome32183218100%0.099%KU501215.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds32183218100%0.099%KU365778.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds32143214100%0.099%KU955589.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome32143214100%0.099%KU870645.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome32143214100%0.099%KU926310.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome32143214100%0.099%KU820899.2Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds32143214100%0.099%KU312312.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds32143214100%0.099%KJ776791.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds32093209100%0.099%KU955590.1Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds32093209100%0.099%KU866423.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome32093209100%0.099%KU853013.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome32093209100%0.099%KU497555.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome32073207100%0.099%KU853012.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome32053205100%0.099%KU922960.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome32053205100%0.099%KU922923.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds32053205100%0.099%KU729217.2Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds32053205100%0.099%KU647676.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds32003200100%0.099%KU820898.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds32003200100%0.099%KU740184.2Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds32003200100%0.099%KU820897.1Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds32003200100%0.099%KU761564.1Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome31823182100%0.099%KU527068.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome31693169100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome31373137100%0.099%KU681081.3Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds31193119100%0.098%KF993678.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome30883088100%0.098%KU955593.1Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds30883088100%0.098%JN860885.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds30633063100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome30613061100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds28452845100%0.095%HQ234499.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds23162316100%0.089%KF268949.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds23162316100%0.089%KF268948.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds23092309100%0.088%KF383118.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds23092309100%0.088%KF268950.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome23072307100%0.088%KU955594.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds23072307100%0.088%KU720415.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID23072307100%0.088%LC002520.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds23072307100%0.088%HQ234498.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome23072307100%0.088%AY632535.2Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds22982298100%0.088%KF383121.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds22982298100%0.088%KF383119.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds22982298100%0.088%KF383115.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds22592259100%0.088%DQ859059.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds22442244100%0.088%KF383116.1Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds22412241100%0.088%HQ234501.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome22352235100%0.088%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome22352235100%0.088%KU955592.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome22352235100%0.088%KU955591.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds22262226100%0.087%HQ234500.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds22232223100%0.087%KF383117.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds2176217667%0.099%KU646827.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds2170217067%0.099%KU646828.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence19921992100%0.085%KF383120.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds93793728%0.0100%KU312315.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds93793728%0.0100%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds93193128%0.099%KU312313.1Select seq gb|DQ859064.1|Spondweni virus strain SM-6 V-1 polyprotein gene, complete cds57457481%2e-15969%DQ859064.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds51851816%1e-14298%KU740199.1Select seq gb|KU872850.1|Zika virus isolate Dominican Rep-Rus-2016, NS2 partial cds47747715%4e-13099%KU872850.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2152156%2e-5199%KJ634273.1
  8. LOCUS KU940227 10551 bp RNA linear VRL 23-MAR-2016 DEFINITION Zika virus isolate Bahia08, partial genome. ACCESSION KU940227 VERSION KU940227.1 GI:1007624013 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10551) AUTHORS Sardi,S.I., Somasekar,S., Bandeira,A.C., Naccache,S.N., Campos,G.S. and Chiu,C.Y. TITLE Metagenomic Next-Generation Sequencing for Detection of Zika and Chikungunya Virus Co-Infections in Bahia, Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10551) AUTHORS Sardi,S.I., Somasekar,S., Bandeira,A.C., Naccache,S.N., Campos,G.S. and Chiu,C.Y. TITLE Direct Submission JOURNAL Submitted (18-MAR-2016) Laboratory Medicine, University of California, San Francisco, 185 Berry Street, Box #0134, San Francisco, CA 94107, USA COMMENT ##Assembly-Data-START## Assembly Method :: SURPI+ v. v1.0; Geneious v. v8.0 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10551 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Bahia08" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="15-Jul-2015" CDS <1..10252 /codon_start=2 /product="polyprotein" /protein_id="AMQ76464.1" /db_xref="GI:1007624014" /translation="SGGFRIVNMLKRGVARVSPFGGLKRLXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRIINARKEKKRRGADTS VGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIXXXXLGHMC DATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAIAWLLGSSTSQKVIYLVMIL LIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVS NMAEVRSYCYEASISDTASDSRCPTQGEAYLDKQSDTQYXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXYRIMLSVHGSQHSGMIVNDTGHETDEXXXXX EITPNSPRAEATLGGFGSLGLDCEPRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XAGADTGTPHWNNKEALXXXXXXXXXXXXXVVLGSQEGAVHTALAGALEAEMDGAKGR LSSGHLKCRLKMDKLRLKGVSYSLCNAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKV PAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHH WHRSGSTIGKAFEATVRGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGCSVDFSKK ETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSRMENIMWR SVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSYFVRAA KTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLECDPAVIG TAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGIEESDLII PKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTRGPSLRST TASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTAGSTDHMD HFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLAILMGATF AEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQTAISALEG DLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLMAWRAGLATCGGFM LLSLKGKGSVKKNLPFVMALGLTAVXXXXXXXVVGLLLLTRSGKRSWPPSEVLTAVGL ICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKDAEVTGNS PRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWXXXXXXGK RSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGSA LRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGXXXXXXXXXXXX XXXXXGDIGAVALDYPAGTSGSPILDKCGRVXXXXXXXXXXXXXXXXXXXTQGRREEE TPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAPTRVVAAE MEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLYIXXXXXX XXXXXXXXXXXXXXXXXMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEVPERAWSS GFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKTKHQEWDF VVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQRRGRIGRN PNKPXXXXLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGX XXXXXXXXXXXXXLMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIMEDSVPAE VWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAXXXXXXXXXXXXXXTER FQEAIDNLAVLMRAETGSRPYKAAAAQMPETLETIMLLGLLGTVSLGIFFVLMRNKGI GKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSPQDNQMAI IIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPASAWAIYA ALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPLLMIGCYS QLTPLTLIVAXXXXXXXXXXXXXGLQAAAARAAQKRTAAGIMKNPVVDGIVVTDIDTM TIDPQVXXXXXXXXXXXXXXXXXXXXXXXXXXGEAGALITAATSTLWEGSPNKYWNSS TATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKXXXXXXXXXXXX XXXXXXXXXVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPHGKVIDLGCG RGGWSYYAATIRKVQEVKGXXXXXXXXXXXXXXXXXXXXXVRLKSGVDVFHMAAEPCD TLLCDXGESSSSPEVEEARTLRVLSMVGDXXXXXXXXXXXXXXXXXXXTMMETLERLQ RRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRPVKYEEDV NLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHGSYEAPTQ GSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRXXXXXXXXXX XXSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAVEAVNDPR FWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGARFLEFEA LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWDTRISRFD LEXXXXXXXXXXXXXXXXXXXXIKYTYQNKVVKVLRPAEKGKTVMDIISRQDXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXGKVRKDTQEWKPSTGWDNWEEVPFCSHHFNKLHLK DGRSIVXXXXXXXXXXXXXXXSPGAGWSIRETACLAKSYAQMWQLLYFHRRDLRLMAN AICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKTPVTKWTD IPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLSTQVRYLGE EGSTPGVL" mat_peptide 2..355 /product="capsid" mat_peptide 356..625 /product="pro" mat_peptide 626..850 /product="membane protein" mat_peptide 851..2365 /product="envelope protein" mat_peptide 2366..3451 /product="NS1" mat_peptide 3452..4105 /product="NS2A" mat_peptide 4106..4537 /product="NS2B" mat_peptide 4538..6346 /product="NS3" mat_peptide 6347..6787 /product="NS4A" mat_peptide 6788..8293 /product="NS4B" mat_peptide 8294..10249 /product="NS5" gap 80..252 /estimated_length=173 gap 651..764 /estimated_length=114 gap 1122..1257 /estimated_length=136 gap 2110..2240 /estimated_length=131 gap 9339..9596 /estimated_length=258 3'UTR 10253..10551 ORIGIN 1 atccggagga ttccggattg tcaatatgct aaaacgcgga gtagcccgtg tgagcccctt 61 tgggggcttg aagaggctg [gap 173 bp] Expand Ns 253 gctgagaa taatcaatgc taggaaggag aagaagagac gaggcgcaga 301 tactagtgtc ggaattgttg gcctcctgct gaccacagct atggcagcgg aggtcactag 361 acgtgggagt gcatactata tgtacttgga cagaaacgat gctggggagg ccatatcttt 421 tccaaccaca ttggggatga ataagtgtta tatacnnnnn nnnnatcttg gacacatgtg 481 tgatgccacc atgagctatg aatgccctat gctggatgag ggggtggaac cagatgacgt 541 cgattgttgg tgcaacacga cgtcaacttg ggttgtgtac ggaacctgcc atcacaaaaa 601 aggtgaagca cggagatcta gaagagctgt gacgctcccc tcccattcca [gap 114 bp] Expand Ns 765 ctgcca tcgcttggct 781 tttgggaagc tcaacgagcc aaaaagtcat atacttggtc atgatactgc tgattgcccc 841 ggcatacagc atcaggtgca taggagtcag caatagggac tttgtggaag gtatgtcagg 901 tgggacttgg gttgatgttg tcttggaaca tggaggttgt gtcaccgtaa tggcacagga 961 caaaccgact gtcgacatag agctggttac aacaacagtc agcaacatgg cggaggtaag 1021 atcctactgc tatgaggcat caatatcaga cacggcttcg gacagccgct gcccaacaca 1081 aggtgaagcc taccttgaca agcaatcaga cactcaatat g [gap 136 bp] Expand Ns 1258 gta 1261 ccggataatg ctgtcagttc atggctccca gcacagtggg atgatcgtta atgacacagg 1321 acatgaaact gatgagannn nnnnnnnnnn ngagataacg cccaattcac caagagccga 1381 agccaccctg gggggttttg gaagcctagg acttgattgt gaaccgagga cnnnnnnnnn 1441 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 1501 nnnnnnnnnn nnnnnnnnnn nnnnnnacgc tggggcagac accggaactc cacactggaa 1561 caacaaagaa gcactgnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngtggt 1621 tctagggagt caagaaggag cagttcacac ggcccttgct ggagctctag aggctgagat 1681 ggatggtgca aagggaaggc tgtcctctgg ccacttgaaa tgtcgcctga aaatggataa 1741 acttagattg aagggcgtgt catactcctt gtgtaacgca gcgttcacat tcaccaagat 1801 cccggctgaa acactgcacg ggacagtcac agtggaggta cagtacgcag ggactgatgg 1861 accttgcaag gttccagctc agatggcggt ggacatgcaa actctgaccc cagttgggag 1921 gttgataacc gctaaccccg taatcactga aagcactgag aactctaaga tgatgctgga 1981 acttgatcca ccatttgggg actcctacat tgtcatagga gtcggggaga agaagatcac 2041 ccaccactgg cacaggagtg gcagcaccat tggaaaagca tttgaagcca ctgtgagagg 2101 tgccaagag [gap 131 bp] Expand Ns 2241 cacaaattct cattggaacg ttgctgatgt ggttgggtct 2281 gaacacaaag aatggatcta tttcccttat gtgcttggcc ttagggggag tgttgatctt 2341 cttatccaca gccgtctctg ctgatgtggg gtgctcggtg gacttctcaa agaaggagac 2401 gagatgcggt acaggggtgt tcgtctataa cgacgttgaa gcctggaggg acaggtacaa 2461 gtaccatcct gactcccccc gtagattggc agcagcagtc aagcaagcct gggaagatgg 2521 tatctgcggg atctcctctg tttcaagaat ggaaaacatc atgtggagat cagtagaagg 2581 ggagctcaac gcaatcctgg aagagaatgg agttcaactg acggtcgttg tgggatctgt 2641 aaaaaacccc atgtggagag gtccacagag attgcccgtg cctgtgaacg agctgcccca 2701 cggctggaag gcttggggga aatcgtactt cgtcagagca gcaaagacaa ataacagctt 2761 tgtcgtggat ggtgacacac tgaaggaatg cccactcaaa catagagcat ggaacagctt 2821 tcttgtggag gatcatgggt tcggggtatt tcacactagt gtctggctca aggttagaga 2881 agattattca ttagagtgtg atccagccgt tattggaaca gctgttaagg gaaaggaggc 2941 tgtacacagt gatctaggct actggattga gagtgagaag aatgacacat ggaggctgaa 3001 gagggcccat ctgatcgaga tgaaaacatg tgaatggcca aagtcccaca cattgtggac 3061 agatggaata gaagagagtg atctgatcat acccaagtct ttagctgggc cactcagcca 3121 tcacaatacc agagagggct acaggaccca aatgaaaggg ccatggcaca gtgaagagct 3181 tgaaattcgg tttgaggaat gcccaggcac taaggtccac gtggaggaaa catgtggaac 3241 aagaggacca tctctgagat caaccactgc aagcggaagg gtgatcgagg aatggtgctg 3301 cagggagtgc acaatgcccc cactgtcgtt ccgggctaaa gatggctgtt ggtatggaat 3361 ggagataagg cccaggaaag aaccagaaag caacttagta aggtcaatgg tgactgcagg 3421 atcaactgat cacatggatc acttctccct tggagtgctt gtgattctgc tcatggtgca 3481 ggaagggctg aagaagagaa tgaccacaaa gatcatcata agcacatcaa tggcagtgct 3541 ggtagctatg atcctgggag gattttcaat gagtgacctg gctaagcttg caattttgat 3601 gggtgccacc ttcgcggaaa tgaacactgg aggagatgta gctcatctgg cgctgatagc 3661 ggcattcaaa gtcagaccag cgttgctggt atctttcatc ttcagagcta attggacacc 3721 ccgtgaaagc atgctgctgg ccttggcctc gtgtcttttg caaactgcga tctccgcctt 3781 ggaaggcgac ctgatggttc tcatcaatgg ttttgctttg gcctggttgg caatacgagc 3841 gatggttgtt ccacgcactg ataacatcac cttggcaatc ttggctgctc tgacaccact 3901 ggcccggggc acactgctta tggcgtggag agcaggcctt gctacttgcg gggggtttat 3961 gctcctctct ctgaagggaa aaggcagtgt gaagaagaac ttaccatttg tcatggccct 4021 gggactaacc gctgtgannn nnnnnnnnnn nnnnnacgtg gtgggactgc tgttgctcac 4081 aaggagtggg aagcggagct ggccccctag cgaagtactc acagctgttg gcctgatatg 4141 cgcattggct ggagggttcg ccaaggcaga tatagagatg gctgggccca tggccgcggt 4201 cggtctgcta attgtcagtt acgtggtctc aggaaagagt gtggacatgt acattgaaag 4261 agcaggtgac atcacatggg aaaaagatgc ggaagtcact ggaaacagtc cccggctcga 4321 tgtggcgcta gatgagagtg gtgatttctc cctggtggag gatgacggtc cccccatgag 4381 agagatcata ctcaaggtgg tcctgatgac catctgtggc atgaacccaa tagccatacc 4441 ctttgcagct ggagcgtggt annnnnnnnn nnnnnntgga aaaaggagtg gtgctctatg 4501 ggatgtgcct gctcccaagg aagtaaaaaa gggggagacc acagatggag tgtacagagt 4561 aatgactcgt agactgctag gttcaacaca agttggagtg ggagttatgc aagagggggt 4621 ctttcacact atgtggcacg tcacaaaagg atccgcgctg agaagcggtg aagggagact 4681 tgatccatac tggggagatg tcaagcagga tctggtgtca tactgtggtc catggaagct 4741 agatgccgcc tgggacgggc acagcgaggt gcagctcttg gccgtgcccc ccggagnnnn 4801 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnngggg acattggagc 4861 ggttgcgctg gattacccag caggaacttc aggatctcca atcctagaca agtgtgggag 4921 agtgatnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 4981 nacccaaggg aggagggagg aagagactcc tgttgagtgc ttcgagcctt cgatgctgaa 5041 gaagaagcag ctaactgtct tagacttgca tcctggagct gggaaaacca ggagagttct 5101 tcctgaaata gtccgtgaag ccataaaaac aagactccgt actgtgatct tagctccaac 5161 cagggttgtc gctgctgaaa tggaggaagc ccttagaggg cttccagtgc gttatatgac 5221 aacagcagtc aatgtcaccc actctggaac agaaatcgtc gacttaatgt gccatgccac 5281 cttcacttca cgtctactac agccaatcag agtccccaat tataatctgt atattatnnn 5341 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 5401 nnnnatgggc gaggcggctg ccatcttcat gaccgccacg ccaccaggaa cccgtgacgc 5461 atttccggac tccaactcac caattatgga caccgaagtg gaagtcccag agagagcctg 5521 gagctcaggc tttgattggg tgacggatca ttctggaaaa acagtttggt ttgttccaag 5581 cgtgaggaac ggcaatgaga tcgcagcttg tctgacaaag gctggaaaac gggtcataca 5641 gctcagcaga aagacttttg agacagagtt ccagaaaaca aaacatcaag agtgggactt 5701 tgtcgtgaca actgacattt cagagatggg cgccaacttt aaagctgacc gtgtcataga 5761 ttccaggaga tgcctaaagc cggtcatact tgatggcgag agagtcattc tggctggacc 5821 catgcctgtc acacatgcca gcgctgccca gaggaggggg cgcataggca ggaatcccaa 5881 caaaccnnnn nnnnnnnnnc tgtatggagg tgggtgcgca gagactgacg aagaccatgc 5941 acactggctt gaagcaagaa tgctccttga caatatttac ctccaagatg gcctcatagc 6001 ctcgctctat cgacctgagg ccgacaaagt agcagccatt gagggnnnnn nnnnnnnnnn 6061 nnnnnnnnnn nnnnnnnnnn nnnnnnaact catgaaaaga ggagatcttc ctgtttggct 6121 ggcctatcag gttgcatctg ccggaataac ctacacagat agaagatggt gctttgatgg 6181 cacgaccaac aacaccataa tggaagacag tgtgccggca gaggtgtgga ccagacacgg 6241 agagaaaaga gtgctcaaac cgaggtggat ggatgccaga gtttgttcag atcatgcggc 6301 cctgaagtca ttcaaggagt ttgccgctgg gaaaagagga gcggctnnnn nnnnnnnnnn 6361 nnnnnnnnnn nnnnnnnnnn nnnnnnngac agagagattc caggaagcca ttgacaacct 6421 cgctgtgctc atgcgggcag agactggaag caggccttac aaagccgcgg cggcccaaat 6481 gccggagacc ctagagacca ttatgctttt ggggttgcta ggaacagtct cgctgggaat 6541 ctttttcgtc ttgatgagga acaagggcat agggaagatg ggctttggaa tggtgactct 6601 tggggccagc gcatggctca tgtggctctc ggaaattgag ccagccagaa ttgcatgtgt 6661 cctcattgtt gtgttcctat tgctggtggt gctcatacct gagccagaaa agcaaagatc 6721 tccccaggac aaccaaatgg caatcatcat catggtagca gtaggtcttc tgggcttgat 6781 taccgccaat gaactcggat ggttggagag aacaaagagt gacctaagcc atctaatggg 6841 aaggagagag gagggggcaa ccataggatt ctcaatggac attgacctgc ggccagcctc 6901 agcttgggcc atctatgctg ccttgacaac tttcattacc ccagccgtcc aacatgcagt 6961 gaccacttca tacaacaact actccttaat ggcgatggcc acgcaagctg gagtgttgtt 7021 tggtatgggc aaagggatgc cattctacgc atgggacttt ggagtcccgc tgctaatgat 7081 aggttgctac tcacaattaa cacccctgac cctaatagtg gccannnnnn nnnnnnnnnn 7141 nnnnnnnnnn nnnnnnnnnn nagggctgca ggcagcagct gcgcgtgctg cccagaagag 7201 aacggcagct ggcatcatga agaaccctgt tgtggatgga atagtggtga ctgacattga 7261 cacaatgaca attgaccccc aagtggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 7321 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggggagg ctggggctct 7381 gatcacagcc gcaacttcca ctttgtggga aggctctccg aacaagtact ggaactcctc 7441 tacagccact tcactgtgta acatttttag gggaagttac ttggctggag cttctctaat 7501 ctacacagta acaagaaacg ctggcttggt caagagacgt gggggtggaa caggagagac 7561 cctgggagag aaatggaagg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 7621 nnnnnnnnnn nnnnnnnnnn nggtgtgcag agaagaggcc cgccgcgccc tcaaggacgg 7681 tgtggcaacg ggaggccatg ctgtgtcccg aggaagtgca aagctgagat ggttggtgga 7741 gcggggatac ctgcagcccc atggaaaggt cattgatctt ggatgtggca gagggggctg 7801 gagttactac gccgccacca tccgcaaagt tcaagaagtg aaaggannnn nnnnnnnnnn 7861 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng tccgtcttaa 7921 gagtggggtg gacgtctttc atatggcggc tgagccgtgt gacacgttgc tgtgtgacat 7981 nggtgagtca tcatctagtc ctgaagtgga agaagcacgg acgctcagag ttctctccat 8041 ggtgggggat nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 8101 nnnnngcact atgatggaaa ccctggagcg actgcagcgt aggtatgggg gaggactggt 8161 cagagtgcca ctctcccgca actctacaca tgagatgtac tgggtctctg gagcgaaaag 8221 caacaccata aaaagtgtgt ccaccacgag ccagctcctc ttggggcgca tggacgggcc 8281 taggaggcca gtgaaatatg aggaggatgt gaatctcggc tctggcacgc gggctgtggt 8341 aagctgcgct gaagctccca acatgaagat cattggtaac cgcattgaaa ggatccgcag 8401 tgagcacgcg gaaacgtggt tctttgacga gaaccaccca tataggacat gggcttacca 8461 tggaagctat gaggccccca cacaagggtc agcgtcctct ctagtaaacg gggttgtcag 8521 gctcctgtca aaaccctggg atgtggtgac tggagtcaca ggaatagcca tgaccgacac 8581 cacaccgtat ggtcagcaaa gagttttcaa ggaaaaagtg gacactaggg nnnnnnnnnn 8641 nnnnnnnnnn nnnnnnnnnn nnnngagcat ggtctcttcc tggttgtgga aagagctagg 8701 caaacacaaa cggccacgag tctgtaccaa agaagagttc atcaacaagg ttcgtagcaa 8761 tgcagcacta ggggcaatat ttgaagagga aaaagagtgg aagactgcag tggaagctgt 8821 gaacgatcca aggttctggg ctctagtgga caaggaaaga gagcaccacc tgagaggaga 8881 gtgccagagt tgtgtgtaca acatgatggg aaaaagagaa aagaaacaag gggaatttgg 8941 aaaggccaag ggcagccgcg ccatctggta tatgtggcta ggggctagat ttctagagtt 9001 cgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg 9061 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc 9121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga 9181 tctggagnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 9241 nnnnnnaatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa 9301 agggaaaaca gttatggaca ttatttcgag acaagacc [gap 258 bp] Expand Ns 9597 tggg 9601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga 9661 agttccgttt tgctcccacc acttcaacaa gctccatctc aaggacggga ggtccattgt 9721 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnntctc caggggcggg 9781 atggagcatc cgggagactg cttgcctagc aaaatcatat gcgcaaatgt ggcagctcct 9841 ttatttccac agaagggacc tccgactgat ggccaatgcc atttgctcat ctgtgccagt 9901 tgactgggtt ccaactggga gaactacctg gtcaatccat ggaaagggag aatggatgac 9961 cactgaagac atgcttgtgg tgtggaacag agtgtggatt gaggagaacg accacatgga 10021 agacaagacc ccagttacga aatggacaga cattccctat ttgggaaaaa gggaagactt 10081 gtggtgtgga tctctcatag ggcacagacc gcgcaccacc tgggctgaga acattaaaaa 10141 cacagtcaac atggtgcgca ggatcatagg tgatgaagaa aagtacatgg actacctatc 10201 cacccaagtt cgctacttgg gtgaagaagg gtctacacct ggagtgctgt aagcaccagt 10261 cttaatgttg tcaggcctgc tagtcagcca cagcttgggg aaagctgtgc agcctgtgac 10321 ccccccagga gaagctggga aaccaagcct atagtcaggc cgagaacgcc atggcacgga 10381 agaagccatg ctgcctgtga gcccctcaga ggacactgag tcaaaaaacc ccacgcgctt 10441 ggaggcgcag gatgggaaaa gaaggtggcg accttcccca cccttcaatc tggggcctga 10501 actggagatc agctgtggat ctccagaaga gggactagtg gttagaggag a //
  9. Sequence map updated https://www.google.com/maps/d/u/0/edit?mid=zv94AJqgUct4.kI8kcFySb4J0&hl=en
  10. Sequences producing significant alignments:Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignmentsSequences producing significant alignments:Select for downloading or viewing reportsDescriptionMax scoreTotal scoreQuery coverE valueIdentAccessionSelect seq gb|KU509998.1|Zika virus strain Haiti/1225/2014, complete genome1882018820100%0.099%KU509998.1Select seq gb|KJ776791.1|Zika virus strain H/PF/2013 polyprotein gene, complete cds1881418814100%0.099%KJ776791.1Select seq gb|KU729218.1|Zika virus isolate BeH828305 polyprotein gene, complete cds1880318803100%0.099%KU729218.1Select seq gb|KU321639.1|Zika virus strain ZikaSPH2015, complete genome1880318803100%0.099%KU321639.1Select seq gb|KU707826.1|Zika virus isolate SSABR1, complete genome1879218792100%0.099%KU707826.1Select seq gb|KU365779.1|Zika virus strain BeH819966 polyprotein gene, complete cds1879218792100%0.099%KU365779.1Select seq gb|KU926309.1|Zika virus isolate Rio-U1, complete genome1877618776100%0.099%KU926309.1Select seq gb|KU365780.1|Zika virus strain BeH815744 polyprotein gene, complete cds1877618776100%0.099%KU365780.1Select seq gb|KU647676.1|Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds1877018770100%0.099%KU647676.1Select seq gb|KU365777.1|Zika virus strain BeH818995 polyprotein gene, complete cds1877018770100%0.099%KU365777.1Select seq gb|KU501217.1|Zika virus strain 8375 polyprotein gene, complete cds1876418764100%0.099%KU501217.1Select seq gb|KU497555.1|Zika virus isolate Brazil-ZKV2015, complete genome187611876199%0.099%KU497555.1Select seq gb|KU729217.2|Zika virus isolate BeH823339 polyprotein gene, complete cds1875918759100%0.099%KU729217.2Select seq gb|KU527068.1|Zika virus strain Natal RGN, complete genome1875918759100%0.099%KU527068.1Select seq gb|KU501216.1|Zika virus strain 103344 polyprotein gene, complete cds1875918759100%0.099%KU501216.1Select seq gb|KU820897.1|Zika virus isolate FLR polyprotein gene, complete cds1875318753100%0.099%KU820897.1Select seq gb|KU501215.1|Zika virus strain PRVABC59, complete genome1875318753100%0.099%KU501215.1Select seq gb|KU365778.1|Zika virus strain BeH819015 polyprotein gene, complete cds1875318753100%0.099%KU365778.1Select seq gb|KU312312.1|Zika virus isolate Z1106033 polyprotein gene, complete cds1875318753100%0.099%KU312312.1Select seq gb|KU922960.1|Zika virus isolate MEX/InDRE/Sm/2016, complete genome1874818748100%0.099%KU922960.1Select seq gb|KU926310.1|Zika virus isolate Rio-S1, complete genome1874218742100%0.099%KU926310.1Select seq gb|KU922923.1|Zika virus isolate MEX/InDRE/Lm/2016, complete genome1874218742100%0.099%KU922923.1Select seq gb|KU853013.1|Zika virus isolate Dominican Republic/2016/PD2, complete genome1874218742100%0.099%KU853013.1Select seq gb|KU853012.1|Zika virus isolate Dominican Republic/2016/PD1, complete genome1874018740100%0.099%KU853012.1Select seq gb|KU870645.1|Zika virus isolate FB-GWUH-2016, complete genome1873718737100%0.099%KU870645.1Select seq gb|KU820898.1|Zika virus isolate GZ01 polyprotein gene, complete cds1872018720100%0.099%KU820898.1Select seq gb|KU955590.1|Zika virus isolate Z16019 polyprotein gene, complete cds1871518715100%0.099%KU955590.1Select seq gb|KU740184.2|Zika virus isolate GD01 polyprotein gene, complete cds1870918709100%0.099%KU740184.2Select seq gb|KU761564.1|Zika virus isolate GDZ16001 polyprotein gene, complete cds1870918709100%0.099%KU761564.1Select seq gb|KU955589.1|Zika virus isolate Z16006 polyprotein gene, complete cds1868718687100%0.099%KU955589.1Select seq gb|KU820899.2|Zika virus isolate ZJ03, complete genome1868718687100%0.099%KU820899.2Select seq gb|KU866423.1|Zika virus isolate Zika virus/SZ01/2016 polyprotein gene, complete cds1855418554100%0.099%KU866423.1Select seq gb|KU744693.1|Zika virus isolate VE_Ganxian, complete genome1851518515100%0.099%KU744693.1Select seq gb|KU681081.3|Zika virus isolate Zika virus/H.sapiens-tc/THA/2014/SV0127- 14, complete genome1839318393100%0.099%KU681081.3Select seq gb|JN860885.1|Zika virus isolate FSS13025 polyprotein gene, partial cds180181801899%0.098%JN860885.1Select seq gb|KU955593.1|Zika virus isolate Zika virus/H.sapiens-tc/KHM/2010/FSS13025, complete genome1801718017100%0.098%KU955593.1Select seq gb|KF993678.1|Zika virus strain PLCal_ZV from Canada polyprotein gene, partial cds180071800798%0.099%KF993678.1Select seq gb|EU545988.1|Zika virus polyprotein gene, complete cds1783217832100%0.098%EU545988.1Select seq gb|KU681082.3|Zika virus isolate Zika virus/H.sapiens-tc/PHL/2012/CPC-0740, complete genome1764517645100%0.098%KU681082.3Select seq gb|HQ234499.1|Zika virus isolate P6-740 polyprotein gene, partial cds163991639999%0.095%HQ234499.1Select seq gb|KF383115.1|Zika virus strain ArB1362 polyprotein gene, complete cds1258912589100%0.089%KF383115.1Select seq gb|KU720415.1|Zika virus strain MR 766 polyprotein gene, complete cds1258712587100%0.089%KU720415.1Select seq gb|KF383119.1|Zika virus strain ArD158084 polyprotein gene, complete cds1258212582100%0.089%KF383119.1Select seq gb|HQ234498.1|Zika virus isolate MR_766 polyprotein gene, partial cds125821258299%0.089%HQ234498.1Select seq gb|KF268948.1|Zika virus isolate ARB13565 polyprotein gene, complete cds1256212562100%0.089%KF268948.1Select seq dbj|LC002520.1|Zika virus genomic RNA, complete genome, strain: MR766-NIID1256012560100%0.089%LC002520.1Select seq gb|KF268950.1|Zika virus isolate ARB7701 polyprotein gene, complete cds1255412554100%0.089%KF268950.1Select seq gb|KF268949.1|Zika virus isolate ARB15076 polyprotein gene, complete cds1254912549100%0.089%KF268949.1Select seq gb|KU955595.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41671-DAK, complete genome1254312543100%0.089%KU955595.1Select seq gb|KU955592.1|Zika virus isolate Zika virus/A.taylori-tc/SEN/1984/41662-DAK, complete genome1253212532100%0.089%KU955592.1Select seq gb|KU955594.1|Zika virus isolate Zika virus/M.mulatta-tc/UGA/1947/MR-766, complete genome1252612526100%0.089%KU955594.1Select seq gb|KF383116.1|Zika virus strain ArD7117 polyprotein gene, complete cds1251512515100%0.089%KF383116.1Select seq gb|KU955591.1|Zika virus isolate Zika virus/A.africanus-tc/SEN/1984/41525-DAK, complete genome1251012510100%0.089%KU955591.1Select seq gb|DQ859059.1|Zika virus strain MR 766 polyprotein gene, complete cds1250412504100%0.089%DQ859059.1Select seq gb|AY632535.2|Zika virus strain MR 766, complete genome1248812488100%0.089%AY632535.2Select seq gb|HQ234501.1|Zika virus isolate ArD_41519 polyprotein gene, partial cds124731247399%0.089%HQ234501.1Select seq gb|KF383117.1|Zika virus strain ArD128000 polyprotein gene, complete cds1242712427100%0.088%KF383117.1Select seq gb|HQ234500.1|Zika virus isolate IbH_30656 polyprotein gene, partial cds123771237799%0.088%HQ234500.1Select seq gb|KF383118.1|Zika virus strain ArD157995 polyprotein gene, complete cds1219812198100%0.088%KF383118.1Select seq gb|KF383121.1|Zika virus strain ArD158095 polyprotein gene, partial cds121941219497%0.089%KF383121.1Select seq gb|KF383120.1|Zika virus strain ArD142623 nonfunctional polyprotein gene, partial sequence9736973697%0.084%KF383120.1Select seq gb|KU312314.1|Zika virus isolate Z1106031 polyprotein gene, partial cds5099509927%0.099%KU312314.1Select seq gb|KU312313.1|Zika virus isolate Z1106032 polyprotein gene, partial cds5066506627%0.099%KU312313.1Select seq gb|KU646828.1|Zika virus isolate Si322 polyprotein gene, partial cds4765476525%0.099%KU646828.1Select seq gb|KU646827.1|Zika virus isolate Si323 polyprotein gene, partial cds4754475425%0.099%KU646827.1Select seq gb|KU312315.1|Zika virus isolate Z1106027 polyprotein gene, partial cds3517351718%0.099%KU312315.1Select seq gb|KU740199.1|Zika virus isolate VE_Ganxian2016 polyprotein gene, partial cds3277327717%0.099%KU740199.1Select seq gb|KJ634273.1|Zika virus strain CK-ISL 2014 E protein (E) gene, partial cds2748274814%0.099%KJ634273.1Select seq gb|KU686218.1|Zika virus isolate MEX/InDRE/14/2015 polyprotein gene, partial cds2098209811%0.099%KU686218.1Select seq gb|KU179098.1|Zika virus isolate JMB-185 nonstructural protein 5 gene, partial cds2049204911%0.099%KU179098.1Select seq gb|KM078936.1|Zika virus strain CHI1410214 NS5 protein gene, partial cds178117819%0.099%KM078936.1Select seq gb|KM078961.1|Zika virus strain CHI2612114 NS5 protein gene, partial cds177717779%0.099%KM078961.1Select seq gb|KM078930.1|Zika virus strain CHI2283714 NS5 protein gene, partial cds177517759%0.099%KM078930.1Select seq gb|KM078971.1|Zika virus strain CHI2613014 NS5 protein gene, partial cds177217729%0.099%KM078971.1Select seq gb|KM078970.1|Zika virus strain CHI2490414 NS5 protein gene, partial cds177217729%0.099%KM078970.1Select seq gb|KM078933.1|Zika virus strain CHI1058514 NS5 protein gene, partial cds177217729%0.099%KM078933.1Select seq gb|KM078929.1|Zika virus strain CHI1805214 NS5 protein gene, partial cds177017709%0.099%KM078929.1Select seq gb|KJ873160.1|Zika virus isolate NC14-03042014-3481 nonstructural protein 5 gene, partial cds162816288%0.099%KJ873160.1Select seq gb|KJ873161.1|Zika virus isolate NC14-02042014-3220 nonstructural protein 5 gene, partial cds144714477%0.099%KJ873161.1Select seq gb|KM851039.1|Zika virus strain SV0127/14 nonstructural protein 5 gene, partial cds139713977%0.099%KM851039.1Select seq gb|KU556802.1|Zika virus isolate MEX/InDRE/14/2015 NS5 protein gene, partial cds137313737%0.099%KU556802.1Select seq gb|KM851038.1|Zika virus strain CPC-0740 nonstructural protein 5 gene, partial cds136313637%0.098%KM851038.1Select seq gb|KU232300.1|Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds126212626%0.099%KU232300.1Select seq gb|KT200609.1|Zika virus isolate BR/949/15 NS5 gene, partial cds125812586%0.099%KT200609.1Select seq gb|KU232290.1|Zika virus isolate 036ZV_PEBR15 NS5 protein gene, partial cds125312536%0.099%KU232290.1Select seq gb|KU232297.1|Zika virus isolate 049ZV_PEBR15 NS5 protein gene, partial cds124912496%0.099%KU232297.1Select seq gb|KU232294.1|Zika virus isolate 061ZV_PEBR15 NS5 protein gene, partial cds124312436%0.099%KU232294.1Select seq gb|KU232292.1|Zika virus isolate 054ZV_PEBR15 NS5 protein gene, partial cds124012406%0.099%KU232292.1Select seq gb|KU232298.1|Zika virus isolate 050ZV_PEBR15 NS5 protein gene, partial cds123612366%0.099%KU232298.1Select seq gb|AF013415.1|Zika virus strain MR-766 NS5 protein (NS5) gene, partial cds123612369%0.088%AF013415.1Select seq gb|KU232296.1|Zika virus isolate 045ZV_PEBR15 NS5 protein gene, partial cds123212326%0.099%KU232296.1Select seq gb|KU232293.1|Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds123212326%0.099%KU232293.1Select seq gb|KU232295.1|Zika virus isolate 068ZV_PEBR15 NS5 protein gene, partial cds122912296%0.099%KU232295.1Select seq gb|KU232288.1|Zika virus isolate 001ZV_PEBR15 NS5 protein gene, partial cds121812186%0.099%KU232288.1Select seq gb|KU232289.1|Zika virus isolate 020ZV_PEBR15 NS5 protein gene, partial cds121412146%0.099%KU232289.1Select seq gb|KU232299.1|Zika virus isolate 015ZV_PEBR15 NS5 protein gene, partial cds121012106%0.099%KU232299.1Select seq gb|KU232291.1|Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds120512056%0.099%KU232291.1Select seq gb|KU758878.1|Zika virus polyprotein gene, partial cds115811586%0.099%KU758878.1Select seq gb|KU867812.1|Zika virus isolate Jiangxi.CHN/01/2016 nonstructural protein 5 gene, partial cds102610265%0.099%KU867812.1
  11. LOCUS KU940228 10676 bp RNA linear VRL 23-MAR-2016 DEFINITION Zika virus isolate Bahia07, partial genome. ACCESSION KU940228 VERSION KU940228.1 GI:1007624023 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10676) AUTHORS Sardi,S.I., Somasekar,S., Bandeira,A.C., Naccache,S.N., Campos,G.S. and Chiu,C.Y. TITLE Metagenomic Next-Generation Sequencing for Detection of Zika and Chikungunya Virus Co-Infections in Bahia, Brazil JOURNAL Unpublished REFERENCE 2 (bases 1 to 10676) AUTHORS Sardi,S.I., Somasekar,S., Bandeira,A.C., Naccache,S.N., Campos,G.S. and Chiu,C.Y. TITLE Direct Submission JOURNAL Submitted (18-MAR-2016) Laboratory Medicine, University of California, San Francisco, 185 Berry Street, Box #0134, San Francisco, CA 94107, USA COMMENT ##Assembly-Data-START## Assembly Method :: SURPI+ v. v1.0; Geneious v. v8.0 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10676 /organism="Zika virus" /mol_type="genomic RNA" /isolate="Bahia07" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="01-Jul-2015" 5'UTR 1..105 CDS 106..10377 /codon_start=1 /product="polyprotein" /protein_id="AMQ76465.1" /db_xref="GI:1007624024" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKGGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAALGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQMPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLMGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPHGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLVNGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMSMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRPEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVTKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" mat_peptide 106..480 /product="capsid" mat_peptide 481..750 /product="pro" mat_peptide 751..975 /product="membane protein" mat_peptide 976..2490 /product="envelope protein" mat_peptide 2491..3576 /product="NS1" mat_peptide 3577..4230 /product="NS2A" mat_peptide 4231..4662 /product="NS2B" mat_peptide 4663..6471 /product="NS3" mat_peptide 6472..6912 /product="NS4A" mat_peptide 6913..8418 /product="NS4B" mat_peptide 8419..10374 /product="NS5" 3'UTR 10378..10676 ORIGIN 1 gttgttgatc tgtgtgaatc agactgcgac agttcgagtt tgaagcgaaa gctagcaaca 61 gtatcaacag gttttatttg gatttggaaa cgagagtttc tggtcatgaa aaacccaaaa 121 aagaaatccg gaggattccg gattgtcaat atgctaaaac gcggagtagc ccgtgtgagc 181 ccctttgggg gcttgaagag gctgccagcc ggacttctgc tgggtcatgg gcccatcagg 241 atggtcttgg cgattctagc ctttttgaga ttcacggcaa tcaagccatc actgggtctc 301 atcaatagat ggggttcagt ggggaaaaaa gaggctatgg aaataataaa gaagttcaag 361 aaagatctgg ctgccatgct gagaataatc aatgctagga aggagaagaa gagacgaggc 421 gcagatacta gtgtcggaat tgttggcctc ctgctgacca cagctatggc agcggaggtc 481 actagacgtg ggagtgcata ctatatgtac ttggacagaa acgatgctgg ggaggccata 541 tcttttccaa ccacattggg gatgaataag tgttatatac agatcatgga tcttggacac 601 atgtgtgatg ccaccatgag ctatgaatgc cctatgctgg atgagggggt ggaaccagat 661 gacgtcgatt gttggtgcaa cacgacgtca acttgggttg tgtacggaac ctgccatcac 721 aaaaaaggtg aagcacggag atctagaaga gctgtgacgc tcccctccca ttccactagg 781 aagctgcaaa cgcggtcgca aacctggttg gaatcaagag aatacacaaa gcacttgatt 841 agagtcgaaa attggatatt caggaaccct ggcttcgcgt tagcagcagc tgccatcgct 901 tggcttttgg gaagctcaac gagccaaaaa gtcatatact tggtcatgat actgctgatt 961 gccccggcat acagcatcag gtgcatagga gtcagcaata gggactttgt ggaaggtatg 1021 tcaggtggga cttgggttga tgttgtcttg gaacatggag gttgtgtcac cgtaatggca 1081 caggacaaac cgactgtcga catagagctg gttacaacaa cagtcagcaa catggcggag 1141 gtaagatcct actgctatga ggcatcaata tcagacatgg cttcggacag ccgctgccca 1201 acacaaggtg aagcctacct tgacaagcaa tcagacactc aatatgtctg caaaagaacg 1261 ttagtggaca gaggctgggg aaatggatgt ggactttttg gcaaagggag cctggtgaca 1321 tgcgctaagt ttgcatgctc caagaaaatg accgggaaga gcatccagcc agagaatctg 1381 gagtaccgga taatgctgtc agttcatggc tcccagcaca gtgggatgat cgttaatgac 1441 acaggacatg aaactgatga gaatagagcg aaggttgaga taacgcccaa ttcaccaaga 1501 gccgaagcca ccctgggggg ttttggaagc ctaggacttg attgtgaacc gaggacaggc 1561 cttgactttt cagatttgta ttacttgact atgaataaca agcactggtt ggttcacaag 1621 gagtggttcc acgacattcc attaccttgg cacgctgggg cagacaccgg aactccacac 1681 tggaacaaca aagaagcact ggtagagttc aaggacgcac atgccaaaag gcaaactgtc 1741 gtggttctag ggagtcaaga aggagcagtt cacacggccc ttgctggagc tctagaggct 1801 gagatggatg gtgcaaaggg aaggctgtcc tctggccact tgaaatgtcg cctgaaaatg 1861 gataaactta gattgaaggg cgtgtcatac tccttgtgta ccgcagcgtt cacattcacc 1921 aagatcccgg ctgaaacact gcacgggaca gtcacagtgg aggtacagta cgcagggact 1981 gatggacctt gcaaggttcc agctcagatg gcggtggaca tgcaaactct gaccccagtt 2041 gggaggttga taaccgctaa ccccgtaatc actgaaagca ctgagaactc taagatgatg 2101 ctggaacttg atccaccatt tggggactcc tacattgtca taggagtcgg ggagaagaag 2161 atcacccacc actggcacag gagtggcagc accattggaa aagcatttga agccactgtg 2221 agaggtgcca agagaatggc agtcttggga gacacagcct gggactttgg atcagttgga 2281 ggcgctctca actcattggg caagggcatc catcaaattt ttggagcagc tttcaaatca 2341 ttgtttggag gaatgtcctg gttctcacaa attctcattg gaacgttgct gatgtggttg 2401 ggtctgaaca caaagaatgg atctatttcc cttatgtgct tggccttagg gggagtgttg 2461 atcttcttat ccacagccgt ctctgctgat gtggggtgct cggtggactt ctcaaagaag 2521 gagacgagat gcggtacagg ggtgttcgtc tataacgacg ttgaagcctg gagggacagg 2581 tacaagtacc atcctgactc cccccgtaga ttggcagcag cagtcaagca agcctgggaa 2641 gatggtatct gcgggatctc ctctgtttca agaatggaaa acatcatgtg gagatcagta 2701 gaaggggagc tcaacgcaat cctggaagag aatggagttc aactgacggt cgttgtggga 2761 tctgtaaaaa accccatgtg gagaggtcca cagagattgc ccgtgcctgt gaacgagctg 2821 ccccacggct ggaaggcttg ggggaaatcg tacttcgtca gagcagcaaa gacaaataac 2881 agctttgtcg tggatggtga cacactgaag gaatgcccac tcaaacatag agcatggaac 2941 agctttcttg tggaggatca tgggttcggg gtatttcaca ctagtgtctg gctcaaggtt 3001 agagaagatt attcattaga gtgtgatcca gccgttattg gaacagctgt taagggaaag 3061 gaggctgtac acagtgatct aggctactgg attgagagtg agaagaatga cacatggagg 3121 ctgaagaggg cccatctgat cgagatgaaa acatgtgaat ggccaaagtc ccacacattg 3181 tggacagatg gaatagaaga gagtgatctg atcataccca agtctttagc tgggccactc 3241 agccatcaca ataccagaga gggctacagg acccaaatga aagggccatg gcacagtgaa 3301 gagcttgaaa ttcggtttga ggaatgccca ggcactaagg tccacgtgga ggaaacatgt 3361 ggaacaagag gaccatctct gagatcaacc actgcaagcg gaagggtgat cgaggaatgg 3421 tgctgcaggg agtgcacaat gcccccactg tcgttccggg ctaaagatgg ctgttggtat 3481 ggaatggaga taaggcccag gaaagaacca gaaagcaact tagtaaggtc aatggtgact 3541 gcaggatcaa ctgatcacat ggatcacttc tcccttggag tgcttgtgat tctgctcatg 3601 gtgcaggaag ggctgaagaa gagaatgacc acaaagatca tcataagcac atcaatggca 3661 gtgctggtag ctatgatcct gggaggattt tcaatgagtg acctggctaa gcttgcaatt 3721 ttgatgggtg ccaccttcgc ggaaatgaac actggaggag atgtagctca tctggcgctg 3781 atagcggcat tcaaagtcag accagcgttg ctggtatctt tcatcttcag agctaattgg 3841 acaccccgtg aaagcatgct gctggccttg gcctcgtgtc ttttgcaaac tgcgatctcc 3901 gccttggaag gcgacctgat ggttctcatc aatggttttg ctttggcctg gttggcaata 3961 cgagcgatgg ttgttccacg cactgataac atcaccttgg caatcttggc tgctctgaca 4021 ccactggccc ggggcacact gcttgtggcg tggagagcag gccttgctac ttgcgggggg 4081 tttatgctcc tctctctgaa gggaaaaggc agtgtgaaga agaacttacc atttgtcatg 4141 gccctgggac taaccgctgt gaggctggtc gaccccatca acgtggtggg actgctgttg 4201 ctcacaagga gtgggaagcg gagctggccc cctagcgaag tactcacagc tgttggcctg 4261 atatgcgcat tggctggagg gttcgccaag gcagatatag agatggctgg gcccatggcc 4321 gcggtcggtc tgctaattgt cagttacgtg gtctcaggaa agagtgtgga catgtacatt 4381 gaaagagcag gtgacatcac atgggaaaaa gatgcggaag tcactggaaa cagtccccgg 4441 ctcgatgtgg cgctagatga gagtggtgat ttctccctgg tggaggatga cggtcccccc 4501 atgagagaga tcatactcaa ggtggtcctg atgaccatct gtggcatgaa cccaatagcc 4561 ataccctttg cagctggagc gtggtacgta tacgtgaaga ctggaaaaag gagtggtgct 4621 ctatgggatg tgcctgctcc caaggaagta aaaaaggggg agaccacaga tggagtgtac 4681 agagtaatga ctcgtagact gctaggttca acacaagttg gagtgggagt tatgcaagag 4741 ggggtctttc acactatgtg gcacgtcaca aaaggatccg cgctgagaag cggtgaaggg 4801 agacttgatc catactgggg agatgtcaag caggatctgg tgtcatactg tggtccatgg 4861 aagctagatg ccgcctggga cgggcacagc gaggtgcagc tcttggccgt gccccccgga 4921 gagagagcga ggaacatcca gactctgccc ggaatattta agacaaaggg tggggacatt 4981 ggagcggttg cgctggatta cccagcagga acttcaggat ctccaatcct agacaagtgt 5041 gggagagtga taggacttta tggcaatggg gtcgtgatca aaaatgggag ttatgttagt 5101 gccatcaccc aagggaggag ggaggaagag actcctgttg agtgcttcga gccttcgatg 5161 ctgaagaaga agcagctaac tgtcttagac ttgcatcctg gagctgggaa aaccaggaga 5221 gttcttcctg aaatagtccg tgaagccata aaaacaagac tccgtactgt gatcttagct 5281 ccaaccaggg ttgtcgctgc tgaaatggag gaagccctta gagggcttcc agtgcgttat 5341 atgacaacag cagtcaatgt cacccactct ggaacagaaa tcgtcgactt aatgtgccat 5401 gccaccttca cttcacgtct actacagcca atcagagtcc ccaattataa tctgtatatt 5461 atggatgagg cccacttcac agatccctca agtatagcag caagaggata catttcaaca 5521 agggttgaga tgggcgaggc ggctgccatc ttcatgaccg ccacgccacc aggaacccgt 5581 gacgcatttc cggactccaa ctcaccaatt atggacaccg aagtggaagt cccagagaga 5641 gcctggagct caggctttga ttgggtgacg gatcattctg gaaaaacagt ttggtttgtt 5701 ccaagcgtga ggaacggcaa tgagatcgca gcttgtctga caaaggctgg aaaacgggtc 5761 atacagctca gcagaaagac ttttgagaca gagttccaga aaacaaaaca tcaagagtgg 5821 gactttgtcg tgacaactga catttcagag atgggcgcca actttaaagc tgaccgtgtc 5881 atagattcca ggagatgcct aaagccggtc atacttgatg gcgagagagt cattctggct 5941 ggacccatgc ctgtcacaca tgccagcgct gcccagagga gggggcgcat aggcaggaat 6001 cccaacaaac ctggagatga gtatctgtat ggaggtgggt gcgcagagac tgacgaagac 6061 catgcacact ggcttgaagc aagaatgctc cttgacaata tttacctcca agatggcctc 6121 atagcctcgc tctatcgacc tgaggccgac aaagtagcag ccattgaggg agagttcaag 6181 cttaggacgg agcaaaggaa gacctttgtg gaactcatga aaagaggaga tcttcctgtt 6241 tggctggcct atcaggttgc atctgccgga ataacctaca cagatagaag atggtgcttt 6301 gatggcacga ccaacaacac cataatggaa gacagtgtgc cggcagaggt gtggaccaga 6361 cacggagaga aaagagtgct caaaccgagg tggatggatg ccagagtttg ttcagatcat 6421 gcggccctga agtcattcaa ggagtttgcc gctgggaaaa gaggagcggc tcttggagtg 6481 atggaagccc tgggaacact gccaggacac atgacagaga gattccagga agccattgac 6541 aacctcgctg tgctcatgcg ggcagagact ggaagcaggc cttacaaagc cgcggcggcc 6601 caaatgccgg agaccctaga gaccattatg cttttggggt tgctaggaac agtctcgctg 6661 ggaatctttt tcgtcttgat gaggaacaag ggcataggga agatgggctt tggaatggtg 6721 actcttgggg ccagcgcatg gctcatgtgg ctctcggaaa ttgagccagc cagaattgca 6781 tgtgtcctca ttgttgtgtt cctattgctg gtggtgctca tacctgagcc agaaaagcaa 6841 agatctcccc aggacaacca aatggcaatc atcatcatgg tagcagtagg tcttctgggc 6901 ttgattaccg ccaatgaact cggatggttg gagagaacaa agagtgacct aagccatcta 6961 atgggaagga gagaggaggg ggcaaccata ggattctcaa tggacattga cctgcggcca 7021 gcctcagctt gggccatcta tgctgccttg acaactttca ttaccccagc cgtccaacat 7081 gcagtgacca cttcatacaa caactactcc ttaatggcga tggccacgca agctggagtg 7141 ttgtttggta tgggcaaagg gatgccattc tacgcatggg actttggagt cccgctgcta 7201 atgataggtt gctactcaca attaacaccc ctgaccctaa tagtggccat cattttgctc 7261 gtggcgcact acatgtactt gatcccaggg ctgcaggcag cagctgcgcg tgctgcccag 7321 aagagaacgg cagctggcat catgaagaac cctgttgtgg atggaatagt ggtgactgac 7381 attgacacaa tgacaattga cccccaagtg gagaaaaaga tgggacaggt gctactcata 7441 gcagtagccg tctccagcgc catactgtcg cggaccgcct gggggtgggg ggaggctggg 7501 gctctgatca cagccgcaac ttccactttg tgggaaggct ctccgaacaa gtactggaac 7561 tcctctacag ccacttcact gtgtaacatt tttaggggaa gttacttggc tggagcttct 7621 ctaatctaca cagtaacaag aaacgctggc ttggtcaaga gacgtggggg tggaacagga 7681 gagaccctgg gagagaaatg gaaggcccgc ttgaaccaga tgtcggccct ggagttctac 7741 tcctacaaaa agtcaggcat caccgaggtg tgcagagaag aggcccgccg cgccctcaag 7801 gacggtgtgg caacgggagg ccatgctgtg tcccgaggaa gtgcaaagct gagatggttg 7861 gtggagcggg gatacctgca gccccatgga aaggtcattg atcttggatg tggcagaggg 7921 ggctggagtt actacgccgc caccatccgc aaagttcaag aagtgaaagg atacacaaaa 7981 ggaggccctg gtcatgaaga acccgtgttg gtgcaaagct atgggtggaa catagtccgt 8041 cttaagagtg gggtggacgt ctttcatatg gcggctgagc cgtgtgacac gttgctgtgt 8101 gacataggtg agtcatcatc tagtcctgaa gtggaagaag cacggacgct cagagttctc 8161 tccatggtgg gggattggct tgaaaaaaga ccaggagcct tttgtataaa agtgttgtgc 8221 ccatacacca gcactatgat ggaaaccctg gagcgactgc agcgtaggta tgggggagga 8281 ctggtcagag tgccactctc ccgcaactct acacatgaga tgtactgggt ctctggagcg 8341 aaaagcaaca ccataaaaag tgtgtccacc acgagccagc tcctcttggg gcgcatggac 8401 gggcctagga ggccagtgaa atatgaggag gatgtgaatc tcggctctgg cacgcgggct 8461 gtggtaagct gcgctgaagc tcccaacatg aagatcattg gtaaccgcat tgaaaggatc 8521 cgcagtgagc acgcggaaac gtggttcttt gacgagaacc acccatatag gacatgggct 8581 taccatggaa gctatgaggc ccccacacaa gggtcagcgt cctctctagt aaacggggtt 8641 gtcaggctcc tgtcaaaacc ctgggatgtg gtgactggag tcacaggaat agccatgacc 8701 gacaccacac cgtatggtca gcaaagagtt ttcaaggaaa aagtggacac tagggtgcca 8761 gacccccaag aaggcactcg tcaggttatg agcatggtct cttcctggtt gtggaaagag 8821 ctaggcaaac acaaacggcc acgagtctgt accaaagaag agttcatcaa caaggttcgt 8881 agcaatgcag cactaggggc aatatttgaa gaggaaaaag agtggaagac tgcagtggaa 8941 gctgtgaacg atccaaggtt ctgggctcta gtggacaagg aaagagagca ccacctgaga 9001 ggagagtgcc agagttgtgt gtacaacatg atgggaaaaa gagaaaagaa acaaggggaa 9061 tttggaaagg ccaagggcag ccgcgccatc tggtatatgt ggctaggggc tagatttcta 9121 gagttcgaag cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga 9181 ggtggtgttg aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc 9241 ataccaggag gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg 9301 tttgatctgg agaatgaagc tctaatcacc aaccaaatgg agaaagggca cagggccttg 9361 gcattggcca taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct 9421 gaaaaaggga aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa 9481 gttgtcactt acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg 9541 gaggctgagg aagttctcga gatgcaagac ttgtggctgc tgcggaggcc agagaaagtg 9601 accaactggt tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat 9661 gattgcgttg tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat 9721 atgggaaaag ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg 9781 gaagaagttc cgttttgctc ccaccacttc aacaagctcc atctcaagga cgggaggtcc 9841 attgtggttc cctgccgcca ccaagatgaa ctgattggcc gggcccgcgt ctctccaggg 9901 gcgggatgga gcatccggga gactgcttgc ctagcaaaat catatgcgca aatgtggcag 9961 ctcctttatt tccacagaag ggacctccga ctgatggcca atgccatttg ctcatctgtg 10021 ccagttgact gggttccaac tgggagaact acctggtcaa tccatggaaa gggagaatgg 10081 atgaccactg aagacatgct tgtggtgtgg aacagagtgt ggattgagga gaacgaccac 10141 atggaagaca agaccccagt tacgaaatgg acagacattc cctatttggg aaaaagggaa 10201 gacttgtggt gtggatctct catagggcac agaccgcgca ccacctgggc tgagaacatt 10261 aaaaacacag tcaacatggt gcgcaggatc ataggtgatg aagaaaagta catggactac 10321 ctatccaccc aagttcgcta cttgggtgaa gaagggtcta cacctggagt gctgtaagca 10381 ccagtcttaa tgttgtcagg cctgctagtc agccacagct tggggaaagc tgtgcagcct 10441 gtgacccccc caggagaagc tgggaaacca agcctatagt caggccgaga acgccatggc 10501 acggaagaag ccatgctgcc tgtgagcccc tcagaggaca ctgagtcaaa aaaccccacg 10561 cgcttggagg cgcaggatgg gaaaagaagg tggcgacctt ccccaccctt caatctgggg 10621 cctgaactgg agatcagctg tggatctcca gaagagggac tagtggttag aggaga
  12. UCSF has released a series of Zika and Chikunguya sequences from co-infected patients in Bahia, Brazil.
  13. Dispatches from America's Zika Virus Epicenter: Puerto RicoThirteen mosquito bites later, here's what you need to know.Joe CarmichaelMarch 26, 2016 I knew I had gotten Zika before I left for Puerto Rico. I knew I had gotten Zika the first morning of my arrival in Culebra, when at least one mosquito bit me four consecutive times in about as many seconds. I knew I had gotten Zika when that one really fucking aggressive mosquito bit me twice on the inside of my right wrist while I was trekking through marsh across Culebrita, and then again when those two bites swelled up to bee-sting size. I knew I had gotten Zika when my final bite count was 13. And I knew I had gotten Zika when a doctor in Manhattan’s Chinatown sent me to an emergency room. Let’s rewind, though, so you can understand where my head was at. I knew next to nothing about Zika, other than that it was a very unfortunate thing occurring elsewhere on the planet, until February 26. On that day, my editor gave me an assignment: listen to the Centers for Disease Control media call and update on Zika, then spin out a story. The two misleading tidbits I excerpted and mentally italicized, bolded, and underlined were A) no one knows anything about this virus and B) Zika-infested Aedes mosquitoes abound in Puerto Rico. My family had planned this trip for some time. It was meant, in part, to be a recuperative venture. Last summer, my sister, Emma, was involved in something along the lines of a car accident. To condense a long, arduous journey, she, eventually, “recovered.” (Quotation marks because imagine trying to fully “recover” — physically, let alone mentally — after a Ford F450 pins you against a Jersey barrier on the edge of a high bridge.) As a family, we decided to celebrate Emma’s resilience with a visit to Culebra, Puerto Rico. Then, Hulk Hogan sued Gawker, and the trial — in which Emma had to testify — coincided with our trip’s dates. The trip that was, in large part, for Emma. Emma completed her testimony and made it to Culebra a couple days after we’d all arrived and acclimated. Upon her arrival, we joked about how predictable it’d be if she got Zika. My initial paranoia, after about a half-dozen bites, had shifted to what I felt was an apathetic, zen-like acceptance. Neither position, I felt, was altogether outlandish. Both legends exist. The CDC and the media are the biggest current purveyors of the former position — the everyone panic position: the CDC has a page dedicated to the virus, much of which speaks in caps lock, and its board’s tone — in media calls, for instance — seems to prophecize doom; swarms of apocalyptic Zika articles hit reactionary news outlets each day. Many apparent contrarians, on the other hand, are shouting at the alarmists to chill — Zika’s like swine flu, man: it’s just, like, a big… hoax. Facts will help us to sort out this mess. We humans have known about Zika since the late 1940s, when it was first isolated — initially in a monkey, then in a mosquito — in the Zika Forest in Uganda. 1952 marked the first evidence of a human infection, in a 10-year-old Nigerian girl. From its discovery in the mid-20th century up until 2007, when the current outbreak began, only 14 human infections were confirmed. That outbreak took off in Micronesia, and was the first known time that the virus escaped its confinement in Africa and Asia. Researchers reported about 50 confirmed cases and 60 probable cases. In April, 2015, Brazil encountered the virus. (And an estimated 1.5 million Brazilians have the virus already.) From there, it rapidly spread throughout Central and South America, Mexico, and then the Caribbean. Though by now it need not be said, research suggests, but does not yet entail, a link between Zika and microcephaly. The continental States — or at least those with Aedes skeeters — are collectively sighing with apprehension. But Puerto Rico — due to its climate, shoddy infrastructure, and abundance of both standing water and mosquitoes — is taking the brunt of the initial wave. The U.S. territory is facing an epidemic, an one that is expected to far surpass anything the eastern seaboard will encounter. Of the island’s 3.55 million inhabitants, almost a million are expected to get the virus within the year. There are already over 250 confirmed cases, a tenth of which are pregnant women. And it’s not even mosquito season yet. Everyone’s doing as best they can to take preventative measures, but the situation looks relatively hopeless. Former Puerto Rico secretary of health Johnny Rullán, who’s currently advising Governor Alejandro García Padilla, told the New York Times: “Come October, when the babies start being born, I’ll know if we acted in time or not.” Even now, in Puerto Rico, it’s likely that far more than 250 people have contracted the virus — for two reasons. Firstly: only one in five infected with Zika are symptomatic. Secondly: the disease’s symptoms are not serious. If you’re in that unlucky 20 percent and are symptomatic, you’re looking, essentially, at a mild version of the flu, paired with a rash and “conjunctivitis eyes,” that’ll clear up in under a week. But back to what was irrefutably a blissful vacation. In Culebra, I doused myself in DEET. No less, as youngest sibling, I dutifully attracted and gave blood to the majority of the mosquitoes we encountered. I acquired a new ability to detect a mosquito’s presence in an enclosed room — the high frequency their flight emits is audible to relatively young and undamaged ears. When outside and vulnerable, I took to intermittently flailing my extremities to scare off unseen pests. In San Juan, before catching a flight home, I witnessed sanitation trucks (evoking the1950s) coating the streets with fragrant anti-mosquito chemicals. Most of all, I became a merciless mosquito seeker and destroyer. And I’ll never look at a mosquito the same way again. Then our trip was over, and it was back to Brooklyn for me. We had a red-eye flight that left San Juan at 2:30 a.m.; I arrived at my apartment around 9 a.m., running on about two hours of seated sleep. Work loomed; a general malaise descended. My eyes were literally red and felt oozy, my muscles and joints ached, and my hard-earned sunburn both raised my body temperature and made me itch. I knew I had Zika. That, or all my symptoms were false positives. So, on my brother’s insistence, I went to a doctor. The doctor confirmed that there was a good chance I had Zika, and — here’s where you’ll learn something — wrote me a prescription. He told me that it was the procedure, that he could not test me. This was a measure to reduce panic, he explained: since Zika is not life-threatening, the powers that be (at least in New York) have decreed that worried travelers and their significant others cannot just wander in to get tested for Zika. Instead, they must see a normal doctor, who can then either confirm or deny their fears based on their symptoms, travels, and so on. If confirmed, the doctor sends the patient to one of several designated Zika-testing emergency rooms. The next day, I went off to one of those emergency rooms. There, I encountered a combination of general suspicion and intrigue. “What are your symptoms, though,” paired with a skeptical side-eye, versus “You got Zika? How’d you get that?” Regardless, they whisked me off to a room. Not long thereafter, a doctor told me he wasn’t going to test me for Zika. “We’re only testing pregnant women,” he said with a smile. “The doctor shouldn’t have sent you. Even if you have Zika, it’s nothing!” Et cetera. But, he said, I probably didn’t: my symptoms were, in all likelihood, false positives. “You’ll be fine.” When I asked him why they weren’t testing everyone, he said that the official, CDC-established testing centers were already overrun with tests, and that pregnant women faced the gravest immediate consequences. And thus I learned that the CDC was sending mixed messages. To the media, it’s inciting fearful tales of Zika’s rampant, mysterious malevolence, of Zika’s sexual transmission. It’s simultaneously making clear that no one knows anything about the long-term effects. To the public, via overly-confident doctors in emergency rooms, the CDC is quashing those same fears. As Zika continues to overtake Puerto Rico, and as Congress continues to neglect the Zika Response and Safety Act, the continental U.S. will undoubtedly be forced to confront the virus this summer. Temperatures will be high enough for Aedesskeeters to flourish, even in New York City, and flights will continue going in and out of Puerto Rico to and from all over the place. It’ll take a handful of infected travelers to bring the virus into the arena, and if one of those diseased is bitten, the biter will likely pass along the virus to another local. (Female mosquitoes — those that bite — live for almost a month.) Voila: a stateside epidemic. But don’t panic: you’ll be fine. Photos via Wikimedia Commons and Flickr and CDC https://www.inverse.com/article/13367-dispatches-from-america-s-zika-virus-epicenter-puerto-rico
  14. Chile reports first case of sexually transmitted ZikaThe Health Ministry says a 46-year-old woman contracted the virus from a man who had become infected in Haiti Agence France-Presse@afpPublished 1:19 AM, March 27, 2016Updated 1:20 AM, March 27, 2016 SANTIAGO, Chile – Authorities on Saturday, March 26, reported the first sexually transmitted case of Zika in mainland Chile, where there is no known presence of the mosquito generally blamed for passing on the virus suspected of causing birth defects. The Health Ministry said a 46-year-old woman contracted the virus from a man who had become infected in Haiti. "This is the first documented case of Zika virus through sexual transmission in mainland Chile, where there is no presence of the Aedes aegypti mosquito that transmits the disease," the ministry said in a statement. "To date, we have confirmed 10 cases of Zika contracted abroad and reported in the country, including 8 in 2016." In early March, Chile reported the first imported case of Zika in a pregnant woman whose son was born healthy. While not present in mainland Chile, the Aedes aegypti mosquito has been detected on remote Easter Island in the Pacific. Zika, which has been spreading through Latin America, has been linked to microcephaly in babies born to mothers infected while pregnant. Microcephaly is a serious birth defect that leaves babies with small heads and incomplete brain development. The World Health Organization has declared an international health emergency over the apparent link. – Rappler.com http://www.rappler.com/world/regions/latin-america/127176-chile-reports-first-case-sexually-transmitted-zika?utm_source=twitter&utm_medium=referral
  15. 1st locally acquired Zika case confirmed in ChileBy ASSOCIATED PRESS PUBLISHED: 13:57 EST, 26 March 2016 | UPDATED: 13:57 EST, 26 March 2016 SANTIAGO, Chile (AP) — Chilean health officials say they've registered the first locally acquired case of the Zika virus, which was sexually transmitted within the country. The Health Ministry said in a statement Saturday that a 46-year-old woman got Zika inside Chile having unprotected sex. Her partner recently returned from a visit to Haiti, where he was infected with the virus. The mosquito Aedes Aegypti that transmits Zika and other viruses including dengue is not present in Chilean continental areas. There previously were 10 confirmed cases of Zika in Chile contracted during travels abroad. Chile's health authorities recommend protected sex for four weeks for people returning from areas where Zika exists. Aedes Aegypti has been detected in the Easter Island territory, in the Pacific Ocean more than 2,100 miles (3,500 kilometers) from Chile's mainland. Read more: http://www.dailymail.co.uk/wires/ap/article-3510723/1st-locally-acquired-Zika-case-confirmed-Chile.html#ixzz4439IzGHN Follow us: @MailOnline on Twitter | DailyMail on Facebook http://www.dailymail.co.uk/wires/ap/article-3510723/1st-locally-acquired-Zika-case-confirmed-Chile.html
  16. Zika virus infected in Colombia rise to more than 58,800International news26/03/2016 21:32 © Reuters. Aedes aegypti mosquito flies after feeding BOGOTA (Reuters) - Colombia recorded 3,114 new cases infected with the virus Zika in the last week, bringing the total since the epidemic began amounted to 58,838, including 10,812 pregnant, reported Saturday the National Institute of Health. The weekly epidemiological bulletin revealed that 381 cases have been reported of neurological syndromes (Guillain-Barre syndrome, ascending polyneuropathy, and similar neurological conditions) with a history of illness compatible with Zika infection. The report also reported 35 cases of acute flaccid paralysis (AFP) in children under 15 years. The PFA is characterized by extreme muscle weakness and complete loss of reflexes. Colombia is the second country with more cases of Zika in Latin America and the Caribbean after Brazil. The epidemic in Colombia began in October last year. But so far, health authorities the South American country have not officially reported any cases of children born with microcephaly associated with Zika virus. Even much information about Zika including whether the virus transmitted by the Aedes aegypti mosquito actually causes microcephaly, a congenital defect that causes the head is abnormally small and that brain development is not complete is unknown. Brazil has confirmed more than 740 cases of microcephaly and finds that most are related to infections in mothers Zika. more than 4,200 additional suspected cases are investigated. The World Health Organization (WHO) said Zika as a global health emergency because it has spread rapidly and "alarming" way, with the risk to affect up to four million people in America. The virus has also been linked to Guillain-Barre syndrome, a rare neurological disorder that can weaken muscles and cause paralysis. Although there is no preventive vaccine Zika, the world's leading pharmaceutical work in search of an antigen against the virus. (Reporting by Luis Jaime Acosta. Edited by Steve Addison) http://es.investing.com/news/world-news/infectados-por-virus-de-zika-en-colombia-suben-a-más-de-58.800-318141
  17. Zika cases in Colombia now total about 59,000 El Espectador / Colombia recorded 58,838 people infected with the virus Zika, of which 10,812 correspond to woman is pregnant, already surpassed the epidemic peak of the virus, which was recorded in February, reported Saturday the National Institute of Health (NIH). according to the latest epidemiological bulletin, in the week between 13 and 19 March "six new confirmed cases and 3,108 suspects clinic" were reported.in total, Colombia reported 58,838 cases of zika since the start of the circulation of the virus, of the 2,361 which were confirmed by laboratory and 56,477 suspects clinics. the scientific community, which continues to investigate the consequences and complications of infection zika, suspected the relationship of this virus with neurological disorders. in Colombia, they have confirmed 997women it is infected pregnant zika, which add 9,815 suspected cases. This is a vulnerable population group by suspicions that the virus causes microcephaly in the fetus. Since the beginning of the epidemic until March 19, 50 babies were born alive with this irreversible congenital malformation. In addition, in the country have been reported 381 cases of neurological syndromes with a history compatible with zika infection. Of these, 258 are sick of Guillain-Barre syndrome (GBS). According to the INS, "a correspondence is observed in the behavior of case reporting SGB and the curve of reported cases of morbidity zika". The newsletter also he noted an increase in cases of acute flaccid paralysis in children under 15 years, all male. If in 2015 Colombia had six cases so far in 2016 reported 29, four in the last week. Colombia gave surpassed this month the epidemic peak virus Zika, recorded during the first two weeks of February, an improvement the faster data than expected. Cartagena, Santa Marta and San Andres island, three of the main tourist spots in the Colombian Caribbean, registered a decline in cases and are entering an endemic phase, according to the INS. However in most of the country remains active circulation of the virus and some departments, such as Meta (center), Quindio (west) and Valle del Cauca (southwest and whose capital is Cali, third largest city in Colombia) are still in the stage of active transmission and infected continue to rise. the zika is transmitted by the mosquito Aedes aegypti, which also spread dengue, Chikungunya and yellow fever. Cases in Colombia zika now total nearly 59,000 with Information the on Twitter @entornoi http://www.entornointeligente.com/articulo/8153119/Casos-de-zika-en-Colombia-suman-ya-cerca-de-59-mil
  18. Saturday March 26, 2016 - 24:49The INS reported 41 cases of microcephaly that could be associated with zikaPhoto: File +1 Tweet 0 Share 1RELATED POSTS"If resources are handled honestly, the system works": health ministerThe Zika came to America in 2013, according to a scientific studyZika 4,251 new cases were reported in ColombiaThey were born 38 children of mothers affected by zikaTests on relationship zika and microcephaly are not yet final, says WHOAvanza test modified Aedes aegypti mosquitoes in FloridaMinsalud recommends territorial authorities delivery of contraceptives in risk areas zikaZika vaccine would be too late to Latin AmericaBY: ADRIANA GIRLIn its latest epidemiological bulletin, the National Institute of Health warns that 10,812 pregnant mothers have suffered from zika, 1053 in Barranquilla and 608 in the Atlantic.Until March 19, 2016 were reported 50 cases of live babies born with microcephaly from all causes, of which 41 could be associated with zika ; Barranquilla reported two. This was confirmed by the National Institute of Health (NIH) in its latest epidemiological bulletin, which also warns that, comparing the historical monthly average of microcephaly in the country, a cumulative total of 30 cases at the same time be expected. And the 67.37% of cases of the disease were reported in females. A total of 10,812 pregnant women have suffered from zika, 1053 in Barranquilla and 608 in the Atlantic. The 51.2% of cases of microcephaly found in Giron (Santander) with 3 cases, Medellin (Antioquia) with 3 cases, 2 cases Barranquilla, El Charco (Nariño) with 2 cases Suaita (Santander) with 2 cases Urrao (Antioquia) with 2 cases. ADVERTISINGinRead invented by TeadsAs already it announced in the past the Ministry of Health, cases of neurological syndromes in the country, including among other pathologies Guillain Barre syndrome, have increased by 60% since the onset of the epidemic zika. The monitoring system INS has notified 381 of these cases. Barranquilla is the second city with the largest number (58) , after Norte de Santander (77). Although the epidemic passed its peak, still appear patients suffering from the virus, which came to 58,838. The departments that account for half of the country's cases are Norte de Santander, Valle del Cauca, Huila, Tolima and Barranquilla that record 53.1% of all reported cases. To date, 31 countries in Latin America have detected HIV transmission. Colombia is the second country most affected by the virus, after Brazil that is the only place where it has detected an increase in cases of microcephaly in newborns. http://www.elheraldo.co/nacional/el-ins-reporta-41-casos-de-microcefalia-que-podrian-estar-asociados-al-zika-250731 TAGSZika virus
  19. National Institute of Health is investigating 41 cases of microcephaly itself relate to zika March 26, 2016 2:48 pm The National Institute of Health -ins Confirmed Saturday that investigates 41 cases of microcephaly in newborns to determine whether these relate to Zika virus. According to the latest bulletin of the INS to date with the Zika virus it has infected a total of 58,838 people in Colombia, and until this week 50 cases of microcephaly are recorded in newborns, nine of which have been negative for zika. The Institute warned that the number of cases may vary "because of the late notification of the event" and warns that compared to the historical monthly average of microcephaly in the country "a cumulative total of 30 cases at the same time be expected". With regard to Guillain Barré, polyneuropathy and other complications associated with zika syndrome, have been reported to the surveillance system 381 cases "with a history of febrile illness consistent with infection" by the virus. According to Colombian government estimates, 500 babies can be born with microcephaly zika in the country and a similar number of people may experience Guillain Barre syndrome, before suggesting a resolution to couples "not pregnant" during the expansion phase of the virus. With respect to the total number infected, the INS updated the figure to 58,838 people, of whom 10,812 are women pregnant. http://www.radiosantafe.com/2016/03/26/instituto-nacional-de-salud-investiga-si-41-casos-de-microcefalia-se-relacionan-con-zika/
  20. Colombia zika recorded 58,838 cases, 10,812 pregnantSince the epidemic began to medidados March, 50 babies were born with microcephaly in Colombia. 17:09 hrs. Saturday 26, March 2016 AFP Colombia recorded 58,838 people infected with the virus Zika, of which 10,812 are pregnant women, and exceeded the epidemic peak of the virus, which was recorded in February, reported Saturday the National Institute of Health (NIH). According to the latest epidemiological bulletin, in the week between 13 and 19 March were reported "six confirmed new cases and 3,108 suspects clinic." In total, Colombia reported 58,838 cases of zika since the start of the circulation of the virus, of which 2,361 were confirmed by laboratory and clinical suspects 56,477. The scientific community, which continues to investigate the consequences and complications of infection zika, suspected the relationship of this virus with neurological disorders. In Colombia, have been confirmed infected pregnant women 997 zika, which add 9,815 suspected cases. This is a vulnerable population group by suspicions that the virus causes microcephaly in the fetus. Since the epidemic began until March 19, 50 babies were born alive with this irreversible congenital malformation. In addition, in the country they have been reported 381 cases of neurological syndromes with a history compatible with zika infection. Of these, 258 are sick of Guillain-Barré Syndrome (GBS). According to the INS, "a correspondence seen in the behavior of SGB case reporting and case reporting curve morbidity zika". The bulletin also noted an increase in cases of acute flaccid paralysis in children under 15 years, all of them male. If in 2015 Colombia had six cases so far reported 29 2016, four in the last week. Colombia gave this month exceeded the epidemic peak Zika virus, recorded during the first two weeks of February, with an improved faster than expected data. Cartagena, Santa Marta and San Andres Island, three of the main tourist spots inthe Colombian Caribbean, recorded a decline in cases and are entering an endemic phase, according to the INS. However, in most of the country remains active circulation of the virus and some departments, such as Meta (center), Quindio (west) and Valle del Cauca (southwest and whose capital is Cali, third largest city in Colombia) are still in the stage of active transmission and infected continue to rise http://www.t13.cl/noticia/mundo/colombia-registra-58.838-casos-zika-10.812-embarazadas
  21. COLOMBIA MARCH 26, 2016 2:12 PM Colombia investigates whether 41 cases of microcephaly are related to the zika July Caio Vasconcelos, who was born with microcephaly, undergoes physical therapy at the Institute for the Blind in Joao Pessoa, Brazil. Andre Penner APEFE LINKEDINGOOGLE+PINTERESTREDDITPRINTORDER A COPY OF THIS ARTICLE BOGOTÁ The National Institute of Health (INS) of Colombia is investigating whether 41 cases of microcephaly in newborns related to Zika virus, which so far has infected a total of 58,838 people. According to the latest bulletin of the INS until the eleventh week of the year 50 cases of microcephaly are recorded in newborns, nine of which have been negative for zika. The Institute, which warned that the number of cases may vary "because of the late notification of the event", said that compared with the historical monthly average of microcephaly in the country "a cumulative total of 30 cases at the same time be expected". With regard to Guillain Barré, polyneuropathy and other complications associated with zika syndrome, have been reported to the surveillance system 381 cases "with a history of febrile illness consistent with infection" by the virus. According to estimates by the Colombian Government, 500 babies may be born with microcephaly in the country by zika and a similar number of people may experience Guillain Barre syndrome, before suggesting a resolution to couples "not pregnant" during the expansion phase virus. With respect to the total number infected, the INS updated the figure to 58,838 people, of whom 10,812 are pregnant women. Virus Zika, transmitted by a mosquito of the genus Aedes, the same one that causes dengue and chikungunya, can cause fever, red eyes without discharge without itching, rash with white or red spots and less frequently muscle and joint pain . Read more here: http://www.elnuevoherald.com/noticias/mundo/america-latina/colombia-es/article68407522.html#storylink=cpyhttp://www.elnuevoherald.com/noticias/mundo/america-latina/colombia-es/article68407522.html
  22. Colombia will investigate more than 40 cases of microcephaly associated with Zika WRITING SDPNOTICIAS.COMSat 26 Mar 2016 13:16 Photo owned by: EFEUntil the eleventh week of the year there have been 50 cases of microcephaly in newborns. Colombia.- The national health authority South American country announced Saturday the opening of an investigation by 41 registered cases of microcephaly , of which it is believed are directly related to Zika virus. ADVERTISINGinRead invented by TeadsAccording to the latest bulletin of the National Institute of Health, until the eleventh week of the year there have been 50 cases of microcephaly in newborns , nine of which have been negative for zika. The number of cases may vary "because of the late notification of the event", said the INS and further noted that compared with the historical monthly average of microcephaly in the country "a cumulative total of 30 cases at the same time be expected". With regard to Guillain Barré, polyneuropathy and other complications associated with zika syndrome, have been reported to the surveillance system 381 cases "with ahistory of febrile illness consistent with infection" by the virus. According to estimates by the Colombian Government, 500 babies may be born with microcephaly in the country by zika and a similar number of people may suffer the syndrome Guillain Barre syndrome , before suggesting a resolution to couples "not pregnant" during the expansion phase virus. With information from EFE http://www.sdpnoticias.com/internacional/2016/03/26/investigara-colombia-mas-de-40-casos-de-microcefalia-asociados-al-zika?utm_source=feedburner&utm_medium=feed&utm_campaign=Feed%3A+SDPnoticiascom+(SDPNoticias.com)
  23. 03/26/2016 15h24 - Updated 26/03/2016 15h26 Colombia considers whether there is a relationship between 41 cases of microcephaly and zikaCountry has recorded nearly 60,000 cases of infection with zika. Country estimates that 500 babies may be born with microcephaly this year. EFE FACEBOOKThe Colombian Maria Camila Davila, is pregnant and was infected by the virus zika; Colombia was one of the countries recommended that women postpone pregnancy (Photo: Schneyder Mendoza / AFP Photo) ZIKAVirus is a global concernunderstand the viruszika and microcephalywhat is already knowndiscoverymyths and truthsaffected countriesThe National Institute of Health (NIH) of Colombia is considering whether 41 cases of microcephaly registered in newborns in the country are related to the virus zika, which so far has infected 58,838 people in the country. According to the latest bulletin of the INS, to date were recorded 50 cases of microcephaly in newborns, nine of them were negative for zika. The agency, which warned that the number of cases may vary "because of the late notification," pointed out that compared to the monthly historical average, "one would expect a cumulative 30 cases in the same period." Regarding the Guillain-Barré syndrome and other complications associated with zika, there were 381 cases "with febrile illness consistent with previous virus infection." According to government estimates Colombia, 500 babies may be born with microcephaly in the country caused by zika. A similar number of people can be a victim of Guillain-Barre syndrome.Therefore, the authorities suggested in a resolution that women should not remain pregnant during the virus expansion. Of the total infected, the INS has raised the number to 58,383 people, including 10,812 pregnant women. http://g1.globo.com/bemestar/noticia/2016/03/colombia-analisa-se-ha-relacao-entre-41-casos-de-microcefalia-e-virus-da-zika.html?utm_source=dlvr.it&utm_medium=twitter
  24. It is investigating whether 41 cases of microcephaly are related to the zikaWith respect to the total number infected, the INS updated the figure to 58,838 people, of whom 10,812 are pregnant women.Photo: File / Colprensa. Recommend on Facebook1Tweet0Send aGoogle PlusSend to LinkedinPin ItSubmitPrintReport errorAssessinterestingoutrageousfunnycontroversysurprisingboring0COMMENTEFE26/03/2016 - (32 minutes ago) The National Institute of Health (INS) of Colombia is investigating whether 41 cases of microcephaly in newborns related to the virus Zika, which to date has infected a total of 58,838 people. According to the latest bulletin of the INS until the eleventh week of the year 50 cases of microcephaly is recorded in newborns, nine of which have been negative for zika. the Institute, which warned that the number of cases may vary "because of the late notification of the event , " said that compared to the historical monthly average of microcephaly in the country "a cumulative total of 30 cases at the same time be expected." regarding the Guillain Barre syndrome, polyneuropathy and other complications associated with zika syndrome have been reported to the surveillance system 381 cases " with a history of febrile illness compatible infected "with the virus.According to estimates by the Colombian government, 500 babies may be born with microcephaly in the country by zika and a similar number of people may experience Guillain Barre syndrome, before suggesting a resolution couples "not pregnant" during the expansion phase of the virus. with respect to the total number infected, the INS updated the figure to 58,838 people, of whom 10,812 are pregnant women. the virus Zika, transmitted by a mosquito the genus Aedes, the same one that causes chikungunya and dengue, can cause fever, red eyes without discharge without itching, rash with white or red spots and less frequently muscle and joint pain. http://www.wradio.com.co/noticias/actualidad/se-investiga-si-41-casos-de-microcefalia-tienen-relacion-con-el-zika/20160326/nota/3093609.aspx
  25. Investigating 41 cases of microcephaly in babies zikaThe National Institute of Health recorded 58,838 cases of the virus in the country, including 10,812 pregnant.Colprensa Zika virus tiger mosquito microcephaly tropical diseases Congenital malformations mosquitos genetic diseases Pregnancy neurological diseases insects Reproduction Epidemic Diseases Animals Medicine Fauna Genetics Health Species Environment biology Natural Sciences ScienceRecommend on Facebook15Tweet0Send aGoogle PlusSend to LinkedinPin ItSubmitPrintReport errorAssessinterestingoutrageousfunnycontroversysurprisingboringCaracol Radio26/03/2016 - 17:17Microcephaly cases have exceeded the usual average for this date and have identified different causes of their appearance. However the National Institute of Health, explained that the figure may vary by entities notified belatedly. To date the Institute recorded 50 cases that would be associated with zika, which were discarded 9 and 41 are maintained in research to determine if the virus is the cause of the disease. Also increased the reporting of other neurological syndromes associated with the virus , if 381 cases of Guillain Barre syndrome, polyneuropathy and other complications are analyzed, they are related to the zika. The number of Colombians with the virus rose to 58,838 , including 10,812 pregnant women, cases that are within government projections. http://caracol.com.co/radio/2016/03/26/salud/1459009027_214389.html

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.