Skip to content
View in the app

A better way to browse. Learn more.

Recombinomics Inc.

A full-screen app on your home screen with push notifications, badges and more.

To install this app on iOS and iPadOS
  1. Tap the Share icon in Safari
  2. Scroll the menu and tap Add to Home Screen.
  3. Tap Add in the top-right corner.
To install this app on Android
  1. Tap the 3-dot menu (⋮) in the top-right corner of the browser.
  2. Tap Add to Home screen or Install app.
  3. Confirm by tapping Install.
Pandemic Potentials Blog

niman

Super Administrators
  • Joined

  • Last visited

Everything posted by niman

  1. December 28, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department issues a Zika virus update when there is a confirmed locally acquired case of Zika. There are three new travel-related cases today with two in Polk and one in Palm Beach. Please visit our website to see the full list of travel-related cases by county. The department updates the travel-related case chart online each weekday. There are three new locally acquired cases today in Miami-Dade County. The department is investigating to determine where exposure occurred. Florida still does not have any identified areas with active Zika transmission. There are two cases in Miami-Dade County residents who had exposure overseas in an area with on-going, active transmission of Zika and exposure in Miami-Dade County so it is not possible to determine whether the case is travel-related or locally acquired. These cases have been added to the undetermined category. The total number of Zika cases reported in Florida as of today is 1,286. Infection Type Infection Count Travel-Related Infections of Zika 1,011 Locally Acquired Infections of Zika 256 Undetermined 19 Pregnant Women with Lab-Evidence of Zika 208 Note, these categories are not mutually exclusive and cannot be added together. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. In order to keep the public informed, the department has posted our investigation process here. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 5 active investigations. The department has closed 47 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,509 people statewide. Florida currently has the capacity to test 5,042 people for active Zika virus and 6,610 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 208. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  2. There are three new travel-related cases today with two in Polk and one in Palm Beach. Please visit our website to see the full list of travel-related cases by county. The department updates the travel-related case chart online each weekday. There are three new locally acquired cases today in Miami-Dade County. The department is investigating to determine where exposure occurred. Florida still does not have any identified areas with active Zika transmission. There are two cases in Miami-Dade County residents who had exposure overseas in an area with on-going, active transmission of Zika and exposure in Miami-Dade County so it is not possible to determine whether the case is travel-related or locally acquired. These cases have been added to the undetermined category. The total number of Zika cases reported in Florida as of today is 1,286. Infection Type Infection Count Travel-Related Infections of Zika 1,011 Locally Acquired Infections of Zika 256 Undetermined 19 Pregnant Women with Lab-Evidence of Zika 208 http://www.floridahealth.gov/newsroom/2016/12/122816-zika-update.html
  3. December 21, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department issues a Zika virus update when there is a confirmed locally acquired case of Zika. There is one new locally acquired case today in Miami-Dade County. The department is investigating to determine where exposure occurred. Florida still does not have any identified areas with active Zika transmission. There are no new travel-related cases today. Please visit our website to see the full list of travel-related cases by county. The department updates the travel-related case chart online each weekday. The total number of Zika cases reported in Florida as of today is 1,272. Infection Type Infection Count Travel-Related Infections of Zika 1,002 Locally Acquired Infections of Zika 253 Undetermined 17 Pregnant Women with Lab-Evidence of Zika 198 Note, these categories are not mutually exclusive and cannot be added together. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. In order to keep the public informed, the department has posted our investigation process here. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 5 active investigations. The department has closed 47 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,356 people statewide. Florida currently has the capacity to test 5,417 people for active Zika virus and 6,842 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 198. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,143 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov
  4. December 21, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department issues a Zika virus update when there is a confirmed locally acquired case of Zika. There is one new locally acquired case today in Miami-Dade County. The department is investigating to determine where exposure occurred. Florida still does not have any identified areas with active Zika transmission. There are no new travel-related cases today. Please visit our website to see the full list of travel-related cases by county. The department updates the travel-related case chart online each weekday. The total number of Zika cases reported in Florida as of today is 1,272. Infection Type Infection Count Travel-Related Infections of Zika 1,002 Locally Acquired Infections of Zika 253 Undetermined 17 Pregnant Women with Lab-Evidence of Zika 198 Note, these categories are not mutually exclusive and cannot be added together. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. In order to keep the public informed, the department has posted our investigation process here. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 5 active investigations. The department has closed 47 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,356 people statewide. Florida currently has the capacity to test 5,417 people for active Zika virus and 6,842 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 198. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,143 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov
  5. There is one new locally acquired case today in Miami-Dade County. The department is investigating to determine where exposure occurred. Florida still does not have any identified areas with active Zika transmission. There are no new travel-related cases today. Please visit our website to see the full list of travel-related cases by county. The department updates the travel-related case chart online each weekday. The total number of Zika cases reported in Florida as of today is 1,272. Infection Type Infection Count Travel-Related Infections of Zika 1,002 Locally Acquired Infections of Zika 253 Undetermined 17 Pregnant Women with Lab-Evidence of Zika 198 http://www.floridahealth.gov/newsroom/2016/12/122116-zika-update.html
  6. There is one new locally acquired case today in Miami-Dade County. The department is investigating to determine where exposure occurred. Florida still does not have any identified areas with active Zika transmission. There are no new travel-related cases today. Please visit our website to see the full list of travel-related cases by county. The department updates the travel-related case chart online each weekday. The total number of Zika cases reported in Florida as of today is 1,272. Infection Type Infection Count Travel-Related Infections of Zika 1,002 Locally Acquired Infections of Zika 253 Undetermined 17 Pregnant Women with Lab-Evidence of Zika 198 http://www.floridahealth.gov/newsroom/2016/12/122116-zika-update.html
  7. December 19, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department issues a Zika virus update that includes information about travel-related and locally acquired cases in Florida. There are no new travel-related cases and no new locally acquired cases today. There is one case in a Miami-Dade County resident who had exposure overseas in an area with on-going, active transmission of Zika and exposure in Miami-Dade County so it is not possible to determine whether the case is travel-related or locally acquired. This case has been added to the undetermined category. Moving forward, the department will only issue a Zika update when there is a locally-acquired case. The department will continue to update the travel-related case chart online each weekday. The total number of Zika cases reported in Florida as of today is 1,263. Infection Type Infection Count Travel-Related Infections of Zika 994 Locally Acquired Infections of Zika 252 Undetermined 17 Pregnant Women with Lab-Evidence of Zika 194 Note, these categories are not mutually exclusive and cannot be added together. Please visit our website to see the full list of travel-related cases by county. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. In order to keep the public informed, the department has posted our investigation process here. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 5 active investigations. The department has closed 47 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,266 people statewide. Florida currently has the capacity to test 5,584 people for active Zika virus and 7,034 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 194. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,143 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  8. December 19, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department issues a Zika virus update that includes information about travel-related and locally acquired cases in Florida. There are no new travel-related cases and no new locally acquired cases today. There is one case in a Miami-Dade County resident who had exposure overseas in an area with on-going, active transmission of Zika and exposure in Miami-Dade County so it is not possible to determine whether the case is travel-related or locally acquired. This case has been added to the undetermined category. Moving forward, the department will only issue a Zika update when there is a locally-acquired case. The department will continue to update the travel-related case chart online each weekday. The total number of Zika cases reported in Florida as of today is 1,263. Infection Type Infection Count Travel-Related Infections of Zika 994 Locally Acquired Infections of Zika 252 Undetermined 17 Pregnant Women with Lab-Evidence of Zika 194 Note, these categories are not mutually exclusive and cannot be added together. Please visit our website to see the full list of travel-related cases by county. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. In order to keep the public informed, the department has posted our investigation process here. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 5 active investigations. The department has closed 47 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,266 people statewide. Florida currently has the capacity to test 5,584 people for active Zika virus and 7,034 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 194. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,143 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  9. There is one case in a Miami-Dade County resident who had exposure overseas in an area with on-going, active transmission of Zika and exposure in Miami-Dade County so it is not possible to determine whether the case is travel-related or locally acquired. This case has been added to the undetermined category. Moving forward, the department will only issue a Zika update when there is a locally-acquired case. The department will continue to update the travel-related case chart online each weekday. The total number of Zika cases reported in Florida as of today is 1,263. Infection Type Infection Count Travel-Related Infections of Zika 994 Locally Acquired Infections of Zika 252 Undetermined 17 Pregnant Women with Lab-Evidence of Zika 194 http://www.floridahealth.gov/newsroom/2016/12/121916-zika-update.html
  10. There are no new travel-related cases and no new locally acquired cases today. There is one case in a Miami-Dade County resident who had exposure overseas in an area with on-going, active transmission of Zika and exposure in Miami-Dade County so it is not possible to determine whether the case is travel-related or locally acquired. This case has been added to the undetermined category. Moving forward, the department will only issue a Zika update when there is a locally-acquired case. The department will continue to update the travel-related case chart online each weekday. The total number of Zika cases reported in Florida as of today is 1,263. Infection Type Infection Count Travel-Related Infections of Zika 994 Locally Acquired Infections of Zika 252 Undetermined 17 Pregnant Women with Lab-Evidence of Zika 194 http://www.floridahealth.gov/newsroom/2016/12/121916-zika-update.html
  11. December 16, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are two new travel-related cases today in Palm Beach County. There is one new locally acquired case today. The individual is a Miami-Dade County resident with multiple possible exposure sites in the county and symptom onset in early November. This does not impact any of the previously lifted zones. The total number of Zika cases reported in Florida as of today is 1,262. Infection Type Infection Count Travel-Related Infections of Zika 994 Locally Acquired Infections of Zika 252 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 193 Note, these categories are not mutually exclusive and cannot be added together. Please visit our website to see the full list of travel-related cases by county. Last week, Governor Rick Scott announced that the department has cleared the Miami Beach area of ongoing, active Zika transmission. The newly cleared area is about 1.5 square miles between 8th and 28th streets. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. The timelines below are as of Dec. 9. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 5 active investigations. The department has closed 47 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,215 people statewide. Florida currently has the capacity to test 5,664 people for active Zika virus and 7,034 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 193. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,143 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  12. December 16, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are two new travel-related cases today in Palm Beach County. There is one new locally acquired case today. The individual is a Miami-Dade County resident with multiple possible exposure sites in the county and symptom onset in early November. This does not impact any of the previously lifted zones. The total number of Zika cases reported in Florida as of today is 1,262. Infection Type Infection Count Travel-Related Infections of Zika 994 Locally Acquired Infections of Zika 252 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 193 Note, these categories are not mutually exclusive and cannot be added together. Please visit our website to see the full list of travel-related cases by county. Last week, Governor Rick Scott announced that the department has cleared the Miami Beach area of ongoing, active Zika transmission. The newly cleared area is about 1.5 square miles between 8th and 28th streets. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. The timelines below are as of Dec. 9. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 5 active investigations. The department has closed 47 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,215 people statewide. Florida currently has the capacity to test 5,664 people for active Zika virus and 7,034 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 193. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,143 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  13. There is one new locally acquired case today. The individual is a Miami-Dade County resident with multiple possible exposure sites in the county and symptom onset in early November. This does not impact any of the previously lifted zones. The total number of Zika cases reported in Florida as of today is 1,262. Infection Type Infection Count Travel-Related Infections of Zika 994 Locally Acquired Infections of Zika 252 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 193 http://www.floridahealth.gov/newsroom/2016/12/121616-zika-update.html
  14. There are two new travel-related cases today in Palm Beach County. There is one new locally acquired case today. The individual is a Miami-Dade County resident with multiple possible exposure sites in the county and symptom onset in early November. This does not impact any of the previously lifted zones. The total number of Zika cases reported in Florida as of today is 1,262. Infection Type Infection Count Travel-Related Infections of Zika 994 Locally Acquired Infections of Zika 252 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 193 http://www.floridahealth.gov/newsroom/2016/12/121616-zika-update.html
  15. December 14, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.— In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are six new travel-related cases today with three in Orange, two in Miami-Dade and one in Lee. There are no new locally acquired cases today. The total number of Zika cases reported in Florida as of today is 1,259. Infection Type Infection Count Travel-Related Infections of Zika 992 Locally Acquired Infections of Zika 251 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 193 Note, these categories are not mutually exclusive and cannot be added together. Please visit our website to see the full list of travel-related cases by county. Last week, Governor Rick Scott announced that the department has cleared the Miami Beach area of ongoing, active Zika transmission. The newly cleared area is about 1.5 square miles between 8th and 28th streets. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. The timelines below are as of Dec. 9. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 6 active investigations. The department has closed 46 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,130 people statewide. Florida currently has the capacity to test 5,881 people for active Zika virus and 5,382 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 193. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,093 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  16. There are six new travel-related cases today with three in Orange, two in Miami-Dade and one in Lee. There are no new locally acquired cases today. The total number of Zika cases reported in Florida as of today is 1,259. Infection Type Infection Count Travel-Related Infections of Zika 992 Locally Acquired Infections of Zika 251 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 193 http://www.floridahealth.gov/newsroom/2016/12/121416-zika-update.html
  17. December 13, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are three new travel-related cases today with two in Orange and one in Miami-Dade. There are two new locally-acquired cases today in Miami-Dade County. The department is investigating to determine where exposure occurred. These cases do not impact the lifting of any previous zone of active transmission in Miami-Dade County. There is also one case in a Miami-Dade resident who had exposure overseas in an area with ongoing, active transmission of Zika and in Miami-Dade so it is not possible to determine whether the case is local or travel-related. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. The total number of Zika cases reported in Florida as of today is 1,253. Infection Type Infection Count Travel-Related Infections of Zika 986 Locally Acquired Infections of Zika 251 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 190 Note, these categories are not mutually exclusive and cannot be added together. Please visit our website to see the full list of travel-related cases by county. Last week, Governor Rick Scott announced that the department has cleared the Miami Beach area of ongoing, active Zika transmission. The newly cleared area is about 1.5 square miles between 8th and 28th streets. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. The timelines below are as of Dec. 9. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 6 active investigations. The department has closed 46 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,031 people statewide. Florida currently has the capacity to test 5,952 people for active Zika virus and 5,430 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 190. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,071 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  18. December 13, 2016 Department of Health Daily Zika Update Contact: Communications [email protected] (850) 245-4111 Tallahassee, Fla.—In an effort to keep Florida residents and visitors safe and aware about the status of the Zika virus, the department will issue a Zika virus update each week day. Updates will include a Zika case count by county and information to keep Floridians informed and prepared. In order to keep the public informed, the department has posted our investigation process here. There are three new travel-related cases today with two in Orange and one in Miami-Dade. There are two new locally-acquired cases today in Miami-Dade County. The department is investigating to determine where exposure occurred. These cases do not impact the lifting of any previous zone of active transmission in Miami-Dade County. There is also one case in a Miami-Dade resident who had exposure overseas in an area with ongoing, active transmission of Zika and in Miami-Dade so it is not possible to determine whether the case is local or travel-related. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. The total number of Zika cases reported in Florida as of today is 1,253. Infection Type Infection Count Travel-Related Infections of Zika 986 Locally Acquired Infections of Zika 251 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 190 Note, these categories are not mutually exclusive and cannot be added together. Please visit our website to see the full list of travel-related cases by county. Last week, Governor Rick Scott announced that the department has cleared the Miami Beach area of ongoing, active Zika transmission. The newly cleared area is about 1.5 square miles between 8th and 28th streets. Florida no longer has any identified areas with active Zika transmission, but we will continue to see isolated cases of local transmission so it is important for residents and visitors in Miami-Dade County to remain vigilant about mosquito bite protection. DOH continues outreach and targeted testing in Miami-Dade County and mosquito abatement and reduction activities are also taking place around the locations that are being investigated. The timelines below are as of Dec. 9. Note: asymptomatic cases are not reflected as they do not have symptom on-set dates. click image above to enlarge click image above to enlarge click image above to enlarge The department is currently conducting 6 active investigations. The department has closed 46 investigations. Information regarding the investigations can be found here. If investigations reveal additional areas of active transmission, the department will announce a defined area of concern. The department has conducted Zika virus testing for more than 11,031 people statewide. Florida currently has the capacity to test 5,952 people for active Zika virus and 5,430 for Zika antibodies. At Governor Scott’s direction, all county health departments now offer free Zika risk assessment and testing to pregnant women. The CDC advises pregnant women should consider postponing travel to Miami-Dade County. If you are pregnant and must travel or if you live or work in Miami-Dade County, protect yourself from mosquito bites by wearing insect repellent, long clothing and limiting your time outdoors. According to CDC guidance, providers should test all pregnant women who lived in, traveled to or whose partner traveled to Miami-Dade County after Aug. 1, 2016. Pregnant women in Miami-Dade County can contact their medical provider or their local county health department to be tested and receive a Zika prevention kit. Additionally, the department is working closely with the Healthy Start Coalition of Miami-Dade County to identify pregnant women in Miami-Dade County to ensure they have access to resources and information to protect themselves. CDC recommends that a pregnant woman with a history of Zika virus and her provider should consider additional ultrasounds. Pregnant women can contact their local county health department for Zika risk assessment and testing hours and information. A Zika risk assessment will be conducted by county health department staff and blood and/or urine samples may be collected and sent to labs for testing. It may take one to two weeks to receive results. Florida has been monitoring pregnant women with evidence of Zika regardless of symptoms. The total number of pregnant women who have been or are being monitored is 190. On Feb. 12, Governor Scott directed the State Surgeon General to activate a Zika Virus Information Hotline for current Florida residents and visitors, as well as anyone planning on traveling to Florida in the near future. The hotline, managed by the Department of Health, has assisted 8,071 callers since it launched. The number for the Zika Virus Information Hotline is 1-855-622-6735. The department urges Floridians to drain standing water weekly, no matter how seemingly small. A couple drops of water in a bottle cap can be a breeding location for mosquitoes. Residents and visitors also need to use repellents when enjoying the Florida outdoors. For more information on DOH action and federal guidance, please click here. For resources and information on Zika virus, click here. About the Florida Department of Health The department, nationally accredited by the Public Health Accreditation Board, works to protect, promote, and improve the health of all people in Florida through integrated state, county and community efforts. Follow us on Twitter at @HealthyFla and on Facebook. For more information about the Florida Department of Health, please visit www.FloridaHealth.gov.
  19. There are two new locally-acquired cases today in Miami-Dade County. The department is investigating to determine where exposure occurred. These cases do not impact the lifting of any previous zone of active transmission in Miami-Dade County. There is also one case in a Miami-Dade resident who had exposure overseas in an area with ongoing, active transmission of Zika and in Miami-Dade so it is not possible to determine whether the case is local or travel-related. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. The total number of Zika cases reported in Florida as of today is 1,253. Infection Type Infection Count Travel-Related Infections of Zika 986 Locally Acquired Infections of Zika 251 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 190 http://www.floridahealth.gov/newsroom/2016/12/121316-zika-update.html
  20. There are three new travel-related cases today with two in Orange and one in Miami-Dade. There are two new locally-acquired cases today in Miami-Dade County. The department is investigating to determine where exposure occurred. These cases do not impact the lifting of any previous zone of active transmission in Miami-Dade County. There is also one case in a Miami-Dade resident who had exposure overseas in an area with ongoing, active transmission of Zika and in Miami-Dade so it is not possible to determine whether the case is local or travel-related. One case does not mean ongoing active transmission is taking place. DOH conducts a thorough investigation by sampling close contacts and community members around each case to determine if additional people are infected. If DOH finds evidence that active transmission is occurring in an area, the media and the public will be notified. The total number of Zika cases reported in Florida as of today is 1,253. Infection Type Infection Count Travel-Related Infections of Zika 986 Locally Acquired Infections of Zika 251 Undetermined 16 Pregnant Women with Lab-Evidence of Zika 190 http://www.floridahealth.gov/newsroom/2016/12/121316-zika-update.html
  21. December 27, 2016 - Weekly Texas Data for National Zika Pregnancy Registry Texas has reported 131 individuals into the CDC’s Zika Pregnancy Registry. The registry includes pregnant women and infants with laboratory evidence of Zika infection, whether or not they ever had symptoms. Texas provides data to the Zika Pregnancy Registry weekly. The registry casts a wider net – beyond reported Zika cases – to track and follow pregnancies that may have been impacted by Zika. States are reporting cases but also the number of pregnancies that can’t be confirmed to be Zika-infected but have some lab indication of a flavivirus infection. Flaviviruses are known to cross-react during antibody testing, making it difficult to determine if the person was infected with Zika or some other flavivirus. Who Texas Counts for the CDC Registry Any pregnant woman or newborn residing in Texas whose testing for Zika virus infection yielded positive or inconclusive test results, regardless of symptoms. Who Texas Counts as Zika Pregnancy Case To be reported as a Zika pregnancy case, the pregnant woman has to have had one or more clinical sign or symptom compatible with Zika and also have a positive Zika test result. Note: Pregnancy Registry counts will be updated weekly. No other details will be provided about Texas pregnancies reported to the CDC due to privacy concerns and that it is not warranted from a public health standpoint. http://www.texaszika.org/
  22. niman replied to niman's topic in Texas
    Zika Virus – December 27, 2016 DSHS and Cameron County Health and Human Services have announced six cases of Zika virus disease likely transmitted by mosquitoes in Texas. Additional information on those cases and the response is available via the news release links above. Through the week ending Dec. 23, Texas has reported 290 cases of illness due to Zika virus. The count includes 21 pregnant women, two infants infected before birth, and two people who had sexual contact with travelers. Texas Zika Cases by County: County (A – H) Cases Angelina 2 Bastrop 1 Bell 7 Bexar 20 Brazoria 1 Brazos 4 Burnet 1 Cameron 16 Collin 5 Dallas 46 Denton 9 El Paso 3 Ellis 1 Fort Bend 10 Frio 1 Galveston 8 Gray 1 Grayson 1 Gregg 1 Hamilton 1 Harris 71 Hidalgo 4 Hockley 1 County (J – W) Cases Jackson 1 Jefferson 2 Jones 1 Lee 1 Lubbock 1 Matagorda 1 Medina 1 Midland 1 Montgomery 1 Navarro 1 Palo Pinto 1 Parker 1 Randall 1 Rusk 1 Smith 1 Starr 1 Tarrant 26 Travis 17 Upshur 1 Val Verde 1 Walker 1 Williamson 5 Webb 6 Wise 1
  23. Sequences producing significant alignments: Select:AllNone Selected:0 AlignmentsDownloadGenBankGraphicsDistance tree of resultsShow/hide columns of the table presenting sequences producing significant alignments Sequences producing significant alignments: Select for downloading or viewing reports Description Max score Total score Query cover E value Ident Accession Select seq gb|KY317936.1| Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC188Se polyprotein gene, complete cds 18969 18969 100% 0.0 100% KY317936.1 Select seq gb|KY317939.1| Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC204Se polyprotein gene, complete cds 18938 18938 100% 0.0 99% KY317939.1 Select seq gb|KY317938.1| Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC199Se polyprotein gene, complete cds 18908 18908 100% 0.0 99% KY317938.1 Select seq gb|KX198135.2| Zika virus strain ZIKV/Homo sapiens/PAN/BEI-259634_V4/2016, complete genome 18897 18897 100% 0.0 99% KX198135.2 Select seq gb|KY014303.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0127-SER polyprotein gene, complete cds 18892 18892 100% 0.0 99% KY014303.1 Select seq gb|KY317940.1| Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC207Se polyprotein gene, complete cds 18886 18886 100% 0.0 99% KY317940.1 Select seq gb|KX156776.2| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259364_V1-V2/2015, complete genome 18886 18886 100% 0.0 99% KX156776.2 Select seq gb|KX156774.2| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259359_V1-V3/2015, complete genome 18881 18881 100% 0.0 99% KX156774.2 Select seq gb|KX156775.2| Zika virus strain ZIKV/Homo sapiens/PAN/CDC-259249_V1-V3/2015, complete genome 18875 18875 100% 0.0 99% KX156775.2 Select seq gb|KX087102.2| Zika virus strain ZIKV/Homo sapiens/COL/FLR/2015, complete genome 18875 18875 100% 0.0 99% KX087102.2 Select seq gb|KU820897.5| Zika virus isolate FLR polyprotein gene, complete cds 18875 18875 100% 0.0 99% KU820897.5 Select seq gb|KX247646.1| Zika virus isolate Zika virus/Homo sapiens/COL/UF-1/2016, complete genome 18875 18875 100% 0.0 99% KX247646.1 Select seq gb|KU647676.1| Zika virus strain MRS_OPY_Martinique_PaRi_2015 polyprotein gene, complete cds 18870 18870 100% 0.0 99% KU647676.1 Select seq gb|KY317937.1| Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC192Se polyprotein gene, complete cds 18853 18853 100% 0.0 99% KY317937.1 Select seq gb|KX702400.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-1/2016, complete genome 18853 18853 100% 0.0 99% KX702400.1 Select seq gb|KX893855.1| Zika virus strain Zika virus/Homo sapiens/VEN/UF-2/2016, complete genome 18851 18851 100% 0.0 99% KX893855.1 Select seq gb|KU922960.1| Zika virus isolate MEX/InDRE/Sm/2016, complete genome 18848 18848 100% 0.0 99% KU922960.1 Select seq gb|KX548902.1| Zika virus isolate ZIKV/COL/FCC00093/2015 polyprotein gene, complete cds 18842 18842 100% 0.0 99% KX548902.1 Select seq gb|KU922923.1| Zika virus isolate MEX/InDRE/Lm/2016, complete genome 18842 18842 100% 0.0 99% KU922923.1 Select seq gb|KX447510.1| Zika virus isolate 1_0049_PF polyprotein gene, complete cds 18820 18820 100% 0.0 99% KX447510.1 Select seq gb|KU991811.1| Zika virus isolate Brazil/2016/INMI1 polyprotein gene, complete cds 18814 18814 100% 0.0 99% KU991811.1 Select seq gb|KY075932.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL001Sa polyprotein gene, complete cds 18809 18809 100% 0.0 99% KY075932.1 Select seq gb|KX447512.1| Zika virus isolate 1_0181_PF polyprotein gene, complete cds 18809 18809 100% 0.0 99% KX447512.1 Select seq gb|KX369547.1| Zika virus strain PF13/251013-18, complete genome 18809 18809 100% 0.0 99% KX369547.1 Select seq gb|KU509998.3| Zika virus strain Haiti/1225/2014, complete genome 18809 18809 100% 0.0 99% KU509998.3 Select seq gb|KJ776791.2| Zika virus strain H/PF/2013, complete genome 18803 18803 100% 0.0 99% KJ776791.2 Select seq gb|KX447509.1| Zika virus isolate 1_0087_PF polyprotein gene, complete cds 18803 18803 100% 0.0 99% KX447509.1 Select seq gb|KX447513.1| Zika virus isolate 1_0134_PF polyprotein gene, complete cds 18798 18798 100% 0.0 99% KX447513.1 Select seq gb|KR872956.1| Zika virus strain 17829 polyprotein gene, complete cds 18792 18792 100% 0.0 99% KR872956.1 Select seq gb|KX197205.1| Zika virus isolate 9, complete genome 18792 18792 100% 0.0 99% KX197205.1 Select seq gb|KX447515.1| Zika virus isolate 1_0030_PF polyprotein gene, complete cds 18792 18792 100% 0.0 99% KX447515.1 Select seq gb|KX447511.1| Zika virus isolate 1_0015_PF polyprotein gene, complete cds 18792 18792 100% 0.0 99% KX447511.1 Select seq gb|KX280026.1| Zika virus isolate Paraiba_01, complete genome 18792 18792 100% 0.0 99% KX280026.1 Select seq gb|KU707826.1| Zika virus isolate SSABR1, complete genome 18792 18792 100% 0.0 99% KU707826.1 Select seq gb|KU365779.1| Zika virus strain BeH819966 polyprotein gene, complete cds 18792 18792 100% 0.0 99% KU365779.1 Select seq gb|KU321639.1| Zika virus strain ZikaSPH2015, complete genome 18792 18792 100% 0.0 99% KU321639.1 Select seq gb|KX447514.1| Zika virus isolate 1_0035_PF polyprotein gene, complete cds 18787 18787 100% 0.0 99% KX447514.1 Select seq gb|KX262887.1| Zika virus isolate 103451, complete genome 18787 18787 100% 0.0 99% KX262887.1 Select seq gb|KX051563.1| Zika virus isolate Haiti/1/2016, complete genome 18787 18787 100% 0.0 99% KX051563.1 Select seq gb|KX447516.1| Zika virus isolate 1_0111_PF polyprotein gene, complete cds 18781 18781 100% 0.0 99% KX447516.1 Select seq gb|KU729218.1| Zika virus isolate BeH828305 polyprotein gene, complete cds 18781 18781 100% 0.0 99% KU729218.1 Select seq gb|KX694534.2| Zika virus strain ZIKV/Homo sapiens/HND/R103451/2015, complete genome 18776 18776 100% 0.0 99% KX694534.2 Select seq gb|KU758877.1| Zika virus isolate 17271 polyprotein gene, complete cds 18776 18776 100% 0.0 99% KU758877.1 Select seq gb|KX197192.1| Zika virus isolate ZIKV/H.sapiens/Brazil/PE243/2015, complete genome 18776 18776 100% 0.0 99% KX197192.1 Select seq gb|KU926309.1| Zika virus isolate Rio-U1, complete genome 18776 18776 100% 0.0 99% KU926309.1 Select seq gb|KU365780.1| Zika virus strain BeH815744 polyprotein gene, complete cds 18776 18776 100% 0.0 99% KU365780.1 Select seq gb|KY014297.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-6864-URI polyprotein gene, complete cds 18774 18774 100% 0.0 99% KY014297.1 Select seq gb|KU497555.1| Zika virus isolate Brazil-ZKV2015, complete genome 18772 18772 99% 0.0 99% KU497555.1 Select seq gb|KX811222.1| Zika virus isolate Brazil_2015_MG, complete genome 18770 18770 100% 0.0 99% KX811222.1 Select seq gb|KU365777.1| Zika virus strain BeH818995 polyprotein gene, complete cds 18770 18770 100% 0.0 99% KU365777.1 Select seq gb|KY328289.1| Zika virus isolate HN16, complete genome 18764 18764 100% 0.0 99% KY328289.1 Select seq gb|KX879604.1| Zika virus isolate SN089, complete genome 18764 18764 100% 0.0 99% KX879604.1 Select seq gb|KU501217.1| Zika virus strain 8375 polyprotein gene, complete cds 18764 18764 100% 0.0 99% KU501217.1 Select seq gb|KU365778.1| Zika virus strain BeH819015 polyprotein gene, complete cds 18764 18764 100% 0.0 99% KU365778.1 Select seq gb|KU312312.1| Zika virus isolate Z1106033 polyprotein gene, complete cds 18764 18764 100% 0.0 99% KU312312.1 Select seq gb|KU940228.1| Zika virus isolate Bahia07, partial genome 18759 18759 100% 0.0 99% KU940228.1 Select seq gb|KU501216.1| Zika virus strain 103344 polyprotein gene, complete cds 18759 18759 100% 0.0 99% KU501216.1 Select seq gb|KY014327.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME167-PLA polyprotein gene, complete cds 18755 18755 100% 0.0 99% KY014327.1 Select seq gb|KY120348.1| Zika virus isolate CIENI551, complete genome 18753 18753 100% 0.0 99% KY120348.1 Select seq gb|KX879603.1| Zika virus isolate SN062, complete genome 18753 18753 100% 0.0 99% KX879603.1 Select seq gb|KX247632.1| Zika virus isolate MEX_I_7 polyprotein gene, complete cds 18753 18753 100% 0.0 99% KX247632.1 Select seq gb|KU937936.1| Zika virus isolate ZIKVNL00013 polyprotein gene, complete cds 18753 18753 100% 0.0 99% KU937936.1 Select seq gb|KU501215.1| Zika virus strain PRVABC59, complete genome 18753 18753 100% 0.0 99% KU501215.1 Select seq gb|KX087101.3| Zika virus strain ZIKV/Homo sapiens/PRI/PRVABC59/2015, complete genome 18748 18748 100% 0.0 99% KX087101.3 Select seq gb|KY014315.1| Zika virus isolate Zika virus/H.sapiens-wt/HND/2016/HU-ME152-SER polyprotein gene, complete cds 18748 18748 100% 0.0 99% KY014315.1 Select seq gb|KX601168.1| Zika virus strain ZIKV/Homo Sapiens/PRI/PRVABC59/2015, complete genome 18748 18748 100% 0.0 99% KX601168.1 Select seq gb|KU729217.2| Zika virus isolate BeH823339 polyprotein gene, complete cds 18748 18748 100% 0.0 99% KU729217.2 Select seq gb|KU527068.1| Zika virus strain Natal RGN, complete genome 18748 18748 100% 0.0 99% KU527068.1 Select seq gb|KX446951.2| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_I-7/2016, complete genome 18742 18742 100% 0.0 99% KX446951.2 Select seq gb|KX856011.1| Zika virus strain ZIKV/Aedes sp./MEX_I-44/2016, complete genome 18742 18742 100% 0.0 99% KX856011.1 Select seq gb|KX447517.1| Zika virus isolate 1_0038_PF polyprotein gene, complete cds 18742 18742 100% 0.0 99% KX447517.1 Select seq gb|KX377337.1| Zika virus strain PRVABC-59, complete genome 18742 18742 100% 0.0 99% KX377337.1 Select seq gb|KU820898.1| Zika virus isolate GZ01 polyprotein gene, complete cds 18742 18742 100% 0.0 99% KU820898.1 Select seq gb|KX269878.1| Zika virus isolate Haiti/2016/PD, complete genome 18739 18739 100% 0.0 99% KX269878.1 Select seq gb|KX446950.2| Zika virus strain ZIKV/Aedes.sp/MEX/MEX_2-81/2016, complete genome 18737 18737 100% 0.0 99% KX446950.2 Select seq gb|KY014304.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0180-SER polyprotein gene, complete cds 18737 18737 100% 0.0 99% KY014304.1 Select seq gb|KX520666.1| Zika virus isolate HS-2015-BA-01 polyprotein gene, complete cds 18737 18737 100% 0.0 99% KX520666.1 Select seq gb|KU870645.1| Zika virus isolate FB-GWUH-2016, complete genome 18737 18737 100% 0.0 99% KU870645.1 Select seq gb|KY075939.1| Zika virus isolate ZIKV/Aedes_aegypti/USA/2016/FL08M polyprotein gene, complete cds 18731 18731 100% 0.0 99% KY075939.1 Select seq gb|KY075933.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL008U polyprotein gene, complete cds 18731 18731 100% 0.0 99% KY075933.1 Select seq gb|KY014296.1| Zika virus isolate Zika virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI polyprotein gene, complete cds 18731 18731 100% 0.0 99% KY014296.1 Select seq gb|KX806557.2| Zika virus isolate TS17-2016, complete genome 18731 18731 100% 0.0 99% KX806557.2 Select seq gb|KU926310.1| Zika virus isolate Rio-S1, complete genome 18731 18731 100% 0.0 99% KU926310.1 Select seq gb|KY075934.1| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL016U polyprotein gene, complete cds 18726 18726 100% 0.0 99% KY075934.1 Select seq gb|KX056898.1| Zika virus isolate Zika virus/GZ02/2016 polyprotein gene, complete cds 18726 18726 100% 0.0 99% KX056898.1 Select seq gb|KU955590.1| Zika virus isolate Z16019 polyprotein gene, complete cds 18726 18726 100% 0.0 99% KU955590.1 Select seq gb|KX766028.1| Zika virus isolate R114916, complete genome 18722 18722 100% 0.0 99% KX766028.1 Select seq gb|KY003153.1| Zika virus strain ZIKV/34997/Pavia/2016 polyprotein gene, complete cds 18720 18720 100% 0.0 99% KY003153.1 Select seq gb|KU740184.2| Zika virus isolate GD01 polyprotein gene, complete cds 18720 18720 100% 0.0 99% KU740184.2 Select seq gb|KU853013.1| Zika virus isolate Dominican Republic/2016/PD2, complete genome 18720 18720 100% 0.0 99% KU853013.1 Select seq gb|KU761564.1| Zika virus isolate GDZ16001 polyprotein gene, complete cds 18720 18720 100% 0.0 99% KU761564.1 Select seq gb|KU853012.1| Zika virus isolate Dominican Republic/2016/PD1, complete genome 18718 18718 100% 0.0 99% KU853012.1 Select seq gb|KY014300.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0208-SER polyprotein gene, complete cds 18715 18715 100% 0.0 99% KY014300.1 Select seq dbj|LC190723.1| Zika virus genomic RNA, complete genome, strain: ZIKV/Hu/Yokohama/1/2016 18715 18715 100% 0.0 99% LC190723.1 Select seq gb|KY120349.1| Zika virus isolate CIENI551, complete genome 18711 18711 100% 0.0 99% KY120349.1 Select seq gb|KY014321.1| Zika virus isolate Zika virus/H.sapiens-wt/DOM/2016/BB-0115-SER polyprotein gene, complete cds 18709 18709 100% 0.0 99% KY014321.1 Select seq gb|KX766029.1| Zika virus isolate R116265, complete genome 18709 18709 100% 0.0 99% KX766029.1 Select seq gb|KY014295.1| Zika virus isolate Zika virus/H.sapiens-wt/USA/2016/FL-010-URI polyprotein gene, complete cds 18703 18703 100% 0.0 99% KY014295.1 Select seq gb|KX842449.2| Zika virus isolate ZIKV/Homo_sapiens/USA/2016/FL010U polyprotein gene, complete cds 18703 18703 100% 0.0 99% KX842449.2 Select seq gb|KY003154.1| Zika virus strain ZIKV/VR10599/Pavia/2016 polyprotein gene, complete cds 18698 18698 100% 0.0 99% KY003154.1
  24. LOCUS KY317936 10389 bp RNA linear VRL 27-DEC-2016 DEFINITION Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC188Se polyprotein gene, complete cds. ACCESSION KY317936 VERSION KY317936.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; Flavivirus. REFERENCE 1 (bases 1 to 10389) AUTHORS Grubaugh,N., Rogers,T., Beutler,N., Fredeking,T., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Burton,D. and Andersen,K. TITLE Zika virus sequenced from Colombia, 2016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 10389) AUTHORS Grubaugh,N., Rogers,T., Beutler,N., Fredeking,T., Gangavarupu,K., Oliveira,G., Robles-Sikisaka,R., Burton,D. and Andersen,K. TITLE Direct Submission JOURNAL Submitted (09-DEC-2016) Department of Immunology and Microbial Science, The Scripps Research Institute, 10550 North Torrey Pines Road, IMM-210, La Jolla, CA 92037, USA COMMENT ##Assembly-Data-START## Assembly Method :: NovoAlign v. V3.04 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10389 /organism="Zika virus" /mol_type="genomic RNA" /isolate="ZIKV/Homo_sapiens/Colombia/2016/ZC188Se" /isolation_source="serum" /host="Homo sapiens" /db_xref="taxon:64320" /country="Colombia" /collection_date="16-Jan-2016" /collected_by="Antibody Systems Inc" CDS 82..10353 /codon_start=1 /product="polyprotein" /protein_id="APQ41782.1" /translation="MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPI RMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKK RRGAETSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQI MDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVT LPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKV IYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIE LVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHET DENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWF HDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAE MDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAG TDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVG EKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFG AAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSADVGC SVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSR MENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLE CDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGI EESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTR GPSLRSTTASGRVIEEWCCRECTMPPLSFWAKDGCWYGMEIRPRKEPESNLVRSMVTA GSTDHMDHFSLGVLVILLMVQEGLKKRMTTKIIISTSMAVLVAMILGGFSMSDLAKLA ILMGATFAEMNTGGDVAHLALIAAFKVRPALLVSFIFRANWTPRESMLLALASCLLQT AISALEGDLMVLINGFALAWLAIRAMVVPRTDNITLAILAALTPLARGTLLVAWRAGL ATCGGFMLLSLKGKGSVKKNLPFVMALGLTAVRLVDPINVVGLLLLTRSGKRSWPPSE VLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKD AEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILKVVLMTICGMNPIAIPFAAGAWY VYVKTGKRSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMW HVTKGSALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGHSEVQLLAVPPGERARN IQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAIT QGRREEETPVECFEPSMLKKKQLTVLDLHPGAGKTRRVLPEIVREAIKTRLRTVILAP TRVVAAEMEEALRGLPVRYMTTAVNVTHSGTEIVDLMCHATFTSRLLQPIRVPNYNLY IMDEAHFTDPSSIAARGYISTRVEMGEAAAIFMTATPPGTRDAFPDSNSPIMDTEVEV PERAWSSGFDWVTDHSGKTVWFVPSVRNGNEIAACLTKAGKRVIQLSRKTFETEFQKT KHQEWDFVVTTDISEMGANFKADRVIDSRRCLKPVILDGERVILAGPMPVTHASAAQR RGRIGRNPNKPGDEYLYGGGCAETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADK VAAIEGEFKLRTEQRKTFVELMKRGDLPVWLAYQVASAGITYTDRRWCFDGTTNNTIM EDSVPAEVWTRHGEKRVLKPRWMDARVCSDHAALKSFKEFAAGKRGAAFGVMEALGTL PGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPETLETIMLLGLLGTVSLGIFFV LMRNKGIGKMGFGMVTLGASAWLMWLSEIEPARIACVLIVVFLLLVVLIPEPEKQRSP QDNQMAIIIMVAVGLLGLITANELGWLERTKSDLSHLLGRREEGATIGFSMDIDLRPA SAWAIYAALTTFITPAVQHAVTTSYNNYSLMAMATQAGVLFGMGKGMPFYAWDFGVPL LMIGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRTAAGIMKNPVVDGIV VTDIDTMTIDPQVEKKMGQVLLIAVAVSSAILSRTAWGWGEAGALITAATSTLWEGSP NKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRRGGGTGETLGEKWKARLNQ MSALEFYSYKKSGITEVCREEARRALKDGVATGGHAVSRGSAKLRWLVERGYLQPYGK VIDLGCGRGGWSYYAATIRKVQEVKGYTKGGPGHEEPVLVQSYGWNIVRLKSGVDVFH MAAEPCDTLLCDIGESSSSPEVEEARTLRVLSMVGDWLEKRPGAFCIKVLCPYTSTMM ETLERLQRRYGGGLVRVPLSRNSTHEMYWVSGAKSNTIKSVSTTSQLLLGRMDGPRRP VKYEEDVNLGSGTRAVVSCAEAPNMKIIGNRIERIRSEHAETWFFDENHPYRTWAYHG SYEAPTQGSASSLINGVVRLLSKPWDVVTGVTGIAMTDTTPYGQQRVFKEKVDTRVPD PQEGTRQVMTMVSSWLWKELGKHKRPRVCTKEEFINKVRSNAALGAIFEEEKEWKTAV EAVNDPRFWALVDKEREHHLRGECQSCVYNMMGKREKKQGEFGKAKGSRAIWYMWLGA RFLEFEALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYADDTAGWD TRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMDIISRQ DQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQSNGWDR LKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVPFCSHH FNKLHLKDGRSIVVPCRHQDELIGRARVSPGAGWSIRETACLAKSYAQMWQLLYFHRR DLRLMANAICSSVPVDWVPTGRTTWSIHGKGEWMTTEDMLVVWNRVWIEENDHMEDKT PVAKWTDIPYLGKREDLWCGSLIGHRPRTTWAENIKNTVNMVRRIIGDEEKYMDYLST QVRYLGEEGSTPGVL" ORIGIN 1 gcgacagttc gagtttgaag cgaaagctag caacagtatc aacaggtttt attttggatt 61 tggaaacgag agtttctggt catgaaaaac ccaaaaaaga aatccggagg attccggatt 121 gtcaatatgc taaaacgcgg agtagcccgt gtgagcccct ttgggggctt gaagaggctg 181 ccagccggac ttctgctggg tcatgggccc atcaggatgg tcttggcgat tctagccttt 241 ttgagattca cggcaatcaa gccatcactg ggtctcatca atagatgggg ttcagtgggg 301 aaaaaagagg ctatggaaat aataaagaag ttcaagaaag atctggctgc catgctgaga 361 ataatcaatg ctaggaagga gaagaagaga cgaggcgcag aaactagtgt cggaattgtt 421 ggcctcctgc tgaccacagc tatggcagcg gaggtcacta gacgtgggag tgcatactat 481 atgtacttgg acagaaacga tgctggggag gccatatctt ttccaaccac attggggatg 541 aataagtgtt atatacagat catggatctt ggacacatgt gtgatgccac catgagctat 601 gaatgcccta tgctggatga gggggtggaa ccagatgacg tcgattgttg gtgcaacacg 661 acgtcaactt gggttgtgta cggaacctgc catcacaaaa aaggtgaagc acggagatct 721 agaagagccg tgacgctccc ctcccattcc actaggaagc tgcaaacgcg gtcgcaaacc 781 tggttggaat caagagaata cacaaagcac ttgattagag tcgaaaattg gatattcagg 841 aaccctggtt tcgctttagc agcagctgcc atcgcttggc ttttgggaag ctcaacgagc 901 caaaaagtca tatacttggt catgatactg ctgattgccc cggcatacag catcaggtgc 961 ataggagtca gcaataggga ctttgtggaa ggtatgtcag gtgggacttg ggttgatgtt 1021 gtcttggaac atggaggttg tgtcaccgta atggcacagg acaaaccgac tgtcgacata 1081 gagctggtta caacaacagt cagcaacatg gcggaggtaa gatcctactg ctatgaggca 1141 tcaatatcag acatggcttc ggacagccgc tgcccaacac aaggtgaagc ctaccttgac 1201 aagcaatcag acactcaata tgtttgcaaa agaacgttag tggacagagg ctggggaaat 1261 ggatgtggac tttttggcaa agggagcctg gtgacatgcg ctaagtttgc atgctccaag 1321 aaaatgaccg ggaagagcat ccagccagag aatctggagt accggataat gttgtcagtt 1381 catggctccc agcacagtgg gatgatcgtt aatgacacag gacatgaaac tgatgagaat 1441 agagcgaagg ttgagataac gcccaattca ccaagagccg aagccaccct ggggggtttt 1501 ggaagcctag gacttgattg tgaaccgagg acaggccttg acttttcaga tttgtattac 1561 ttgactatga ataacaagca ctggttggtt cacaaggagt ggttccacga cattccatta 1621 ccttggcacg ctggggcaga caccggaact ccacactgga acaacaaaga agcactggta 1681 gagttcaagg acgcacatgc caaaaggcaa actgtcgtgg ttctagggag tcaagaagga 1741 gcagttcaca cggcccttgc tggagctctg gaggctgaga tggatggtgc aaagggaagg 1801 ctgtcctctg gccacttgaa atgtcgcctg aaaatggata aacttagatt gaagggcgtg 1861 tcatactcct tgtgtaccgc agcgttcaca ttcaccaaga tcccggctga aacactgcac 1921 gggacagtca cagtggaggt acagtacgca gggacagatg gaccttgcaa ggttccagct 1981 cagatggcgg tggacatgca aactctgacc ccagttggga ggttgataac cgctaacccc 2041 gtaatcactg aaagcactga gaactctaag atgatgctgg aacttgatcc accatttggg 2101 gactcttaca ttgtcatagg agtcggggag aagaagatca cccaccactg gcataggagt 2161 ggcagcacca ttggaaaagc atttgaagcc actgtgagag gtgccaagag aatggcagtc 2221 ttgggagaca cagcctggga ctttggatca gttggaggcg ctctcaactc attgggcaag 2281 ggcatccatc aaatttttgg agcagctttc aaatcattgt ttggaggaat gtcctggttc 2341 tcacaaattc tcattggaac gttgctgatg tggttgggtc tgaacacaaa gaatggatct 2401 atttccctta tgtgcttggc cttaggggga gtgttgatct tcttatccac agccgtctct 2461 gctgatgtgg ggtgctcggt ggacttctca aagaaggaga cgagatgtgg tacaggggtg 2521 ttcgtctata acgacgttga agcctggagg gacaggtaca agtaccatcc tgactccccc 2581 cgtagattgg cagcagcagt caagcaagcc tgggaagatg gtatctgcgg gatctcctct 2641 gtttcaagaa tggaaaacat catgtggaga tcagtagaag gggagctcaa cgcaatcctg 2701 gaagagaatg gagttcaact gacggtcgtt gtgggatctg taaaaaaccc catgtggaga 2761 ggtccacaga gattgcccgt gcctgtgaac gagctgcccc acggctggaa ggcttggggg 2821 aaatcgtact tcgtcagagc agcaaagaca aataacagct ttgtcgtgga tggtgacaca 2881 ctgaaggaat gcccactcaa acatagagca tggaacagct ttcttgtgga ggatcatggg 2941 ttcggggtat ttcacactag tgtctggctc aaggttagag aagattattc attagagtgt 3001 gatccagccg ttattggaac agctgttaag ggaaaggagg ctgtacacag tgatctaggc 3061 tactggattg agagtgagaa gaatgacaca tggaggctga agagggccca tctgatcgag 3121 atgaaaacat gtgaatggcc aaagtcccac acattgtgga cagatggaat agaagagagt 3181 gatctgatca tacccaagtc tttagctggg ccactcagcc atcacaatac cagagagggc 3241 tacaggaccc aaatgaaagg gccatggcac agtgaagagc ttgaaattcg gtttgaggaa 3301 tgcccaggca ctaaggtcca cgtggaggaa acatgtggaa caagaggacc atctctgaga 3361 tcaaccactg caagcggaag ggtgatcgag gaatggtgct gcagggagtg cacaatgccc 3421 ccactgtcgt tctgggctaa agatggctgt tggtatggaa tggagataag gcccaggaaa 3481 gaaccagaaa gcaacttagt aaggtcaatg gtgactgcag gatcaactga tcacatggat 3541 cacttctccc ttggagtgct tgtgattctg ctcatggtgc aggaagggct gaagaagaga 3601 atgaccacaa agatcatcat aagcacatca atggcagtgc tggtagctat gatcctggga 3661 ggattttcaa tgagtgacct ggctaagctt gcaattttga tgggtgccac cttcgcggaa 3721 atgaacactg gaggagatgt agctcatctg gcgctgatag cggcattcaa agtcagacca 3781 gcgttgctgg tatctttcat cttcagagct aattggacac cccgtgaaag catgctgctg 3841 gccttggcct cgtgtctttt gcaaactgcg atctccgcct tggagggcga cctgatggtt 3901 ctcatcaatg gttttgcttt ggcctggttg gcaatacgag cgatggttgt tccacgcact 3961 gacaacatca ccttggcaat cctggctgct ctgacaccac tggcccgggg cacactgctt 4021 gtggcgtgga gagcaggcct tgctacttgc ggggggttta tgctcctctc tctgaaggga 4081 aaaggcagtg tgaagaagaa cttaccattt gtcatggccc tgggactaac cgctgtgagg 4141 ctggtcgacc ccatcaacgt ggtgggactg ctgttgctca caaggagtgg gaagcggagc 4201 tggcccccta gcgaagtact cacagctgtt ggcctgatat gcgcattggc tggagggttc 4261 gccaaggcag atatagagat ggctgggccc atggccgcgg tcggtctgct aattgtcagt 4321 tacgtggtct caggaaagag tgtggacatg tacattgaaa gagcaggtga catcacatgg 4381 gaaaaagatg cggaagtcac tggaaacagt ccccggctcg atgtggcgct agatgagagt 4441 ggtgatttct ccctggtgga ggatgacggt ccccccatga gagagatcat actcaaggtg 4501 gtcctgatga ccatctgtgg catgaaccca atagccatac cctttgcagc tggagcgtgg 4561 tacgtatacg tgaagactgg aaaaaggagt ggtgctctat gggatgtgcc tgctcccaag 4621 gaagtaaaaa agggggagac cacagatgga gtgtacagag taatgactcg tagactgcta 4681 ggttcaacac aagttggagt gggagttatg caagaggggg tctttcacac tatgtggcac 4741 gtcacaaaag gatccgcgct gagaagcggt gaagggagac ttgatccata ctggggagat 4801 gtcaagcagg atctggtgtc atactgtggt ccatggaagc tagatgccgc ctgggacggg 4861 cacagcgagg tgcagctctt ggccgtgccc cccggagaga gagcgaggaa catccagact 4921 ctgcccggaa tatttaagac aaaggatggg gacattggag cggttgcgct ggattaccca 4981 gcaggaactt caggatctcc aatcctagac aagtgtggga gagtgatagg actttatggc 5041 aatggggtcg tgatcaaaaa tgggagttat gttagtgcca tcacccaagg gaggagggag 5101 gaagagactc ctgttgagtg cttcgagcct tcgatgctga agaagaagca gctaactgtc 5161 ttagacttgc atcctggagc tgggaaaacc aggagagttc ttcctgaaat agtccgtgaa 5221 gccataaaaa caagactccg tactgtgatc ttagctccaa ccagggttgt cgctgctgaa 5281 atggaggagg cccttagagg gcttccagtg cgttatatga caacagcagt caatgtcacc 5341 cactctggaa cagaaatcgt cgacttaatg tgccatgcca ccttcacttc acgtctacta 5401 cagccaatca gagtccccaa ctataatctg tatattatgg atgaggccca cttcacagat 5461 ccctcaagta tagcagcaag aggatacatt tcaacaaggg ttgagatggg cgaggcggct 5521 gccatcttca tgaccgccac gccaccagga acccgtgacg catttccgga ctccaactca 5581 ccaattatgg acaccgaagt ggaagtccca gagagagcct ggagctcagg ctttgattgg 5641 gtgacggatc attctggaaa aacagtttgg tttgttccaa gcgtgaggaa cggcaatgag 5701 atcgcagctt gtctgacaaa ggctggaaaa cgggttatac agctcagcag aaagactttt 5761 gagacagagt tccagaaaac aaaacatcaa gagtgggact ttgtcgtgac aactgacatt 5821 tcagagatgg gcgccaactt taaagctgac cgtgtcatag attccaggag atgcctaaag 5881 ccggtcatac ttgatggcga gagagtcatt ctggctggac ccatgcctgt cacacatgcc 5941 agcgctgccc agaggagggg gcgcataggc aggaatccca ataaacctgg agatgagtat 6001 ctgtatggag gtgggtgcgc agagactgac gaagaccatg cacactggct tgaagcaaga 6061 atgctccttg acaatattta cctccaagat ggcctcatag cctcgctcta tcgacctgag 6121 gccgacaaag tagcagccat tgagggagag ttcaagctta ggacggagca aaggaagacc 6181 tttgtggaac tcatgaaaag aggagatctt cctgtttggc tggcctatca ggttgcatct 6241 gccggaataa cctacacaga tagaagatgg tgctttgatg gcacgaccaa caacaccata 6301 atggaagaca gtgtgccggc agaggtgtgg accagacacg gagagaaaag agtgctcaaa 6361 ccgaggtgga tggacgccag agtttgttca gatcatgcgg ccctgaagtc attcaaggag 6421 tttgccgctg ggaaaagagg agcggctttt ggagtgatgg aagccctggg aacactgcca 6481 ggacacatga cagagagatt ccaggaagcc attgacaacc tcgctgtgct catgcgggca 6541 gagactggaa gcaggcctta caaagccgcg gcggcccaat tgccggagac cctagagacc 6601 attatgcttt tggggttgct gggaacagtc tcgctgggaa tctttttcgt cttgatgagg 6661 aacaagggca tagggaagat gggctttgga atggtgactc ttggggccag cgcatggctc 6721 atgtggctct cggaaattga gccagccaga attgcatgtg tcctcattgt tgtgttccta 6781 ttgctggtgg tgctcatacc tgagccagaa aagcaaagat ctccccagga caaccaaatg 6841 gcaatcatca tcatggtagc agtaggtctt ctgggcttga ttaccgccaa tgaactcgga 6901 tggttggaga gaacaaagag tgacctaagc catctactgg gaaggagaga ggagggggca 6961 accataggat tctcaatgga cattgacctg cggccagcct cagcttgggc catctatgct 7021 gccttgacaa ctttcattac cccagccgtc caacatgcag tgaccacttc atacaacaac 7081 tactccttaa tggcgatggc cacgcaagct ggagtgttgt ttggtatggg caaagggatg 7141 ccattctacg catgggactt tggagtcccg ctgctaatga taggttgcta ctcacaatta 7201 acacccctga ccctaatagt ggccatcatt ttgctcgtgg cgcactacat gtacttgatc 7261 ccagggctgc aggcagcagc tgcgcgtgct gcccagaaga gaacggcagc tggcatcatg 7321 aagaaccctg ttgtggatgg aatagtggtg actgacattg acacaatgac aattgacccc 7381 caagtggaga aaaagatggg acaggtgcta ctcatagcag tagccgtctc cagcgccata 7441 ctgtcgcgga ccgcctgggg gtggggggag gctggggccc tgatcacagc cgcaacttcc 7501 actttgtggg aaggctctcc gaacaagtac tggaactcct ctacagccac ttcactgtgt 7561 aacattttta ggggaagtta cttggctgga gcttctctaa tctacacagt aacaagaaac 7621 gctggcttgg tcaagagacg tgggggtgga acaggagaga ccctgggaga gaaatggaag 7681 gcccgcttga accagatgtc ggccctggag ttctactcct acaaaaagtc aggcatcacc 7741 gaggtgtgca gagaagaggc ccgccgcgcc ctcaaggacg gtgtggcaac gggaggccat 7801 gctgtgtccc gaggaagtgc aaagctgaga tggctggtgg agcggggata cctgcagccc 7861 tatggaaagg tcattgatct tggatgtggc agagggggct ggagttacta cgccgccacc 7921 atccgcaaag ttcaagaagt gaaaggatac acaaaaggag gccctggtca tgaagaaccc 7981 gtgttggtgc aaagctatgg gtggaacata gtccgtctta agagtggggt ggacgtcttt 8041 catatggcgg ctgagccgtg tgacacgttg ctgtgtgaca taggtgagtc atcatctagt 8101 cctgaagtgg aagaagcacg gacgctcaga gtcctctcca tggtggggga ttggcttgaa 8161 aaaagaccag gagccttttg tataaaagtg ttgtgcccat acaccagcac tatgatggaa 8221 accctggagc gactgcagcg taggtatggg ggaggactgg tcagagtgcc actctcccgc 8281 aactctacac atgagatgta ctgggtctct ggagcgaaaa gcaacaccat aaaaagtgtg 8341 tccaccacga gccagctcct cttggggcgc atggacgggc ctaggaggcc agtgaaatat 8401 gaggaggatg tgaatctcgg ctctggcacg cgggctgtgg taagctgcgc tgaagctccc 8461 aacatgaaga tcattggtaa ccgcattgaa aggatccgca gtgagcacgc ggaaacgtgg 8521 ttctttgacg agaaccaccc atataggaca tgggcttacc atggaagcta tgaggccccc 8581 acacaagggt cagcgtcctc tctaataaac ggggttgtca ggctcctgtc aaaaccctgg 8641 gatgtggtga ctggagtcac aggaatagcc atgaccgaca ccacaccgta tggtcagcaa 8701 agagttttca aggaaaaagt ggacactagg gtgccagacc cccaagaagg cactcgtcag 8761 gttatgacca tggtctcttc ctggttgtgg aaagagctag gcaaacacaa acggccacga 8821 gtctgtacca aagaagagtt catcaacaag gttcgtagca atgcagcatt aggggcaata 8881 tttgaagagg aaaaagagtg gaagactgca gtggaagctg tgaacgatcc aaggttctgg 8941 gctctagtgg acaaggaaag agagcaccac ctgagaggag agtgccagag ttgtgtgtac 9001 aacatgatgg gaaaaagaga aaagaaacaa ggggaatttg gaaaggccaa gggcagccgc 9061 gccatctggt atatgtggct aggggctaga tttctagagt tcgaagccct tggattcttg 9121 aacgaggatc actggatggg gagagagaac tcaggaggtg gtgttgaagg gctgggatta 9181 caaagactcg gatatgtcct agaagagatg agtcgcatac caggaggaag gatgtatgca 9241 gatgacactg ctggctggga cacccgcatt agcaggtttg atctggagaa tgaagctcta 9301 atcaccaacc aaatggagaa agggcacagg gccttggcat tggccataat caagtacaca 9361 taccaaaaca aagtggtaaa ggtccttaga ccagctgaaa aagggaaaac agttatggac 9421 attatttcga gacaagacca aagggggagc ggacaagttg tcacttacgc tcttaacaca 9481 tttaccaacc tagtggtgca actcattcgg aatatggagg ctgaggaagt tctagagatg 9541 caagacttgt ggctgctgcg gaggtcagag aaagtgacca actggttgca gagcaacgga 9601 tgggataggc tcaaacgaat ggcagtcagt ggagatgatt gcgttgtgaa gccaattgat 9661 gataggtttg cacatgccct caggttcttg aatgatatgg gaaaagttag gaaggacaca 9721 caagagtgga aaccctcaac tggatgggac aactgggaag aagttccgtt ttgctcccac 9781 cacttcaaca agctccatct caaggacggg aggtccattg tggttccctg ccgccaccaa 9841 gatgaactga ttggccgggc ccgcgtctct ccaggggcgg gatggagcat ccgggagact 9901 gcttgcctag caaaatcata tgcgcaaatg tggcagctcc tttatttcca cagaagggac 9961 ctccgactga tggccaatgc catttgttca tctgtgccag ttgactgggt tccaactggg 10021 agaactacct ggtcaatcca tggaaaggga gaatggatga ccactgaaga catgcttgtg 10081 gtgtggaaca gagtgtggat tgaggagaac gaccacatgg aagacaagac cccagttgcg 10141 aaatggacag acattcccta tttgggaaaa agggaagact tgtggtgtgg atctctcata 10201 gggcacagac cgcgcaccac ctgggctgag aacattaaaa acacagtcaa catggtgcgc 10261 aggatcatag gtgatgaaga aaagtacatg gactacctat ccacccaagt tcgctacttg 10321 ggcgaagaag ggtctacacc tggagtgctg taagcaccaa tcttaatgtt gtcaggcctg 10381 ctagtcagc
  25. Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC188Se polyprotein gene, complete cds 10,389 bp linear RNA Accession: KY317936.1 GI: 1124099354 GenBankFASTAGraphics Select item 11240993568. Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC192Se polyprotein gene, complete cds 10,462 bp linear RNA Accession: KY317937.1 GI: 1124099356 GenBankFASTAGraphics Select item 11240993589. Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC199Se polyprotein gene, complete cds 10,387 bp linear RNA Accession: KY317938.1 GI: 1124099358 GenBankFASTAGraphics Select item 112409936010. Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC204Se polyprotein gene, complete cds 10,608 bp linear RNA Accession: KY317939.1 GI: 1124099360 GenBankFASTAGraphics Select item 112409936211. Zika virus isolate ZIKV/Homo_sapiens/Colombia/2016/ZC207Se polyprotein gene, complete cds 10,391 bp linear RNA Accession: KY317940.1 GI: 1124099362 GenBankFASTAGraphics

Account

Navigation

Search

Search

Configure browser push notifications

Chrome (Android)
  1. Tap the lock icon next to the address bar.
  2. Tap Permissions → Notifications.
  3. Adjust your preference.
Chrome (Desktop)
  1. Click the padlock icon in the address bar.
  2. Select Site settings.
  3. Find Notifications and adjust your preference.